PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g040948m
Common NameCISIN_1g040948mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family M-type_MADS
Protein Properties Length: 287aa    MW: 32202.5 Da    PI: 5.4951
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g040948mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF49.17.1e-162566950
                       HHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
             SRF-TF  9 rqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                       rq  f kR++++  KA+EL +LCd+ v+++ ++++gk+ +++
  orange1.1g040948m 25 RQGNFEKRKETLKNKAHELETLCDVMVCLVCYGPDGKVETWP 66
                       8889*************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004328.4E-6767IPR002100Transcription factor, MADS-box
PROSITE profilePS5006612.376969IPR002100Transcription factor, MADS-box
CDDcd002667.90E-19986No hitNo description
PRINTSPR004048.3E-61131IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.32E-181395IPR002100Transcription factor, MADS-box
PfamPF003191.6E-142365IPR002100Transcription factor, MADS-box
PRINTSPR004048.3E-63146IPR002100Transcription factor, MADS-box
PRINTSPR004048.3E-64667IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MDAETTQVKR KRSVKLIEEH GGNSRQGNFE KRKETLKNKA HELETLCDVM VCLVCYGPDG  60
KVETWPEDKT KVNDMIDKYK ELREMPVLMK KAEQRLDLLE LFESKKQKLM EKKKAFVEKM  120
FSILETKIDE ASSVEELGVV YNKVESKLAS MRETIELAII EEQKNQQFAA PPIRPPVYGN  180
NLLLSDYVSS SSNNNNNNND FGRHESFLFP PSQNHQINGG ENGNIGDNVM LPDNNFLPSE  240
IGNNFMLPDN SLLPGYVHAN KGAWAQENFS GLIGGPCCNC GRGPSS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024948395.10.0agamous-like MADS-box protein AGL103
RefseqXP_024948396.10.0agamous-like MADS-box protein AGL103
TrEMBLA0A067E6X70.0A0A067E6X7_CITSI; Uncharacterized protein
STRINGXP_006491544.10.0(Citrus sinensis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM56620126
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18650.16e-15AGAMOUS-like 103