PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g040485m
Common NameCISIN_1g040485mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family M-type_MADS
Protein Properties Length: 116aa    MW: 13766.9 Da    PI: 10.6814
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g040485mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF51.61.2e-161563149
                       S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
             SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                       k+ien+  r +tfskRr gi KKA+E  +L+   +a+++fs++gk y +
  orange1.1g040485m 15 KKIENEDDRLITFSKRRSGIYKKASEFVTLTSSAIAIVVFSQSGKPYIF 63
                       68******************************************97765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004324.4E-21766IPR002100Transcription factor, MADS-box
PROSITE profilePS5006621.446767IPR002100Transcription factor, MADS-box
CDDcd001202.23E-21863No hitNo description
SuperFamilySSF554552.62E-22995IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-16929IPR002100Transcription factor, MADS-box
PfamPF003191.1E-191663IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-162944IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-164465IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 116 aa     Download sequence    Send to blast
MAGKKTKRRQ KIEMKKIENE DDRLITFSKR RSGIYKKASE FVTLTSSAIA IVVFSQSGKP  60
YIFLHNDNIH PLVKAYRHAR INELNQQHND LLRQLDEEKE QEKMLKQMRR VKETQP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006492961.17e-59agamous-like MADS-box protein AGL62
TrEMBLA0A067FGU96e-80A0A067FGU9_CITSI; Uncharacterized protein (Fragment)
STRINGXP_006492961.13e-58(Citrus sinensis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM8628390
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04100.11e-24AGAMOUS-like 57