PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g040161m
Common NameCISIN_1g040161mg, LOC102612105
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family Dof
Protein Properties Length: 367aa    MW: 39163.4 Da    PI: 9.1537
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g040161mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.57e-3985144362
             zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                        +++l+cprCds+ntkfCyynny+l+qPr+fCk+CrryWtkGGalrnvP+Ggg+rknk+ss
  orange1.1g040161m  85 NQNLRCPRCDSSNTKFCYYNNYNLTQPRHFCKTCRRYWTKGGALRNVPIGGGCRKNKSSS 144
                        68899****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027011.3E-3286142IPR003851Zinc finger, Dof-type
ProDomPD0074783.0E-2586141IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.51688142IPR003851Zinc finger, Dof-type
PROSITE patternPS01361090126IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 367 aa     Download sequence    Send to blast
MIQELLGAAG FISGDRKISI TGSIFEGTTS PLPPCTTTTT ATVTTTTATA APPPPPPPLP  60
TTTTSNTDSN IGNNTNNTSS NSGNNQNLRC PRCDSSNTKF CYYNNYNLTQ PRHFCKTCRR  120
YWTKGGALRN VPIGGGCRKN KSSSTVTAAS FGKSSSSSSA ANKMKTVAYE IGRGGFVHHP  180
HEYYSSTPIM WNNSPHNSQL LALLRTSQNP NINPTGPSTS TSSVRVKEEQ GVIGTHHVIK  240
GEPVGDTAAV LNSGTMVFNP LSQQLQVPSQ LGLWKNNQHQ IQAPQQNGFL VGHEVQNSGV  300
QELYQRFKSS TNNYYADHLA SPVVLSNAAS STTTILESAP VAGGELGYWN PVFSWSDLST  360
TNGSYP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1447493e-46EF144749.1 Populus trichocarpa clone WS01117_M16 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006425821.10.0hypothetical protein CICLE_v10025912mg
RefseqXP_006466656.10.0PREDICTED: dof zinc finger protein DOF5.1
RefseqXP_015389449.10.0PREDICTED: dof zinc finger protein DOF5.1
TrEMBLA0A067GV740.0A0A067GV74_CITSI; Uncharacterized protein
TrEMBLV4SPL70.0V4SPL7_9R
STRINGPOPTR_0007s11620.11e-106(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16000915
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.13e-33TARGET OF MONOPTEROS 6