PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g039654m
Common NameCISIN_1g039654mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family M-type_MADS
Protein Properties Length: 226aa    MW: 25205 Da    PI: 9.724
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g039654mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF694.3e-222266549
                       SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
             SRF-TF  5 nksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                       n+sn qvtfskRr+g++KKA+EL++LC+a++a+i+fs+  k++ +
  orange1.1g039654m 22 NESNLQVTFSKRRTGLFKKASELCTLCGADIAIIVFSPGKKVFSF 66
                       89************************************9999887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006623.1421070IPR002100Transcription factor, MADS-box
SMARTSM004324.1E-311069IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.57E-261186IPR002100Transcription factor, MADS-box
CDDcd002651.50E-341180No hitNo description
PRINTSPR004044.6E-181232IPR002100Transcription factor, MADS-box
PfamPF003192.7E-242166IPR002100Transcription factor, MADS-box
PRINTSPR004044.6E-183247IPR002100Transcription factor, MADS-box
PRINTSPR004044.6E-184768IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009960Biological Processendosperm development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    Send to blast
MSGMSSKKSK GRQKVEMVKM PNESNLQVTF SKRRTGLFKK ASELCTLCGA DIAIIVFSPG  60
KKVFSFGHPC VETIVDRYLT RNPPQISGTM QLIEAHRNAS VRELNMQLTQ VLNQLEIEKK  120
RGEELNQMRK ASQAQCWWEA PIEELNLPQL EQLKMSLEEL KKNVGKQAEK MLIQSSNPPQ  180
FFAGSSSNAG GMNLPFDPNN NAAVFNPNNM MPHPGYNPGF GHGFY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3kov_A2e-151195186Myocyte-specific enhancer factor 2A
3kov_B2e-151195186Myocyte-specific enhancer factor 2A
3kov_I2e-151195186Myocyte-specific enhancer factor 2A
3kov_J2e-151195186Myocyte-specific enhancer factor 2A
3p57_A2e-151195186Myocyte-specific enhancer factor 2A
3p57_B2e-151195186Myocyte-specific enhancer factor 2A
3p57_C2e-151195186Myocyte-specific enhancer factor 2A
3p57_D2e-151195186Myocyte-specific enhancer factor 2A
3p57_I2e-151195186Myocyte-specific enhancer factor 2A
3p57_J2e-151195186Myocyte-specific enhancer factor 2A
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed during the syncytial endosperm development. {ECO:0000269|PubMed:18334668}.
UniprotTISSUE SPECIFICITY: Expressed in the endosperm but not in the embryo. Detected in young siliques, roots, leaves, stems, young flowers and anthers. {ECO:0000269|PubMed:18334668}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. Required for suppression of cellularization and promotion of nuclear proliferation during early endosperm development. The FERTILIZATION-INDEPENDENT SEED (FIS) polycomb complex is required for suppression of ALG62 expression at the end of the syncytial phase of endosperm development. {ECO:0000269|PubMed:18334668}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006487058.21e-165agamous-like MADS-box protein AGL62
SwissprotQ9FKK22e-72AGL62_ARATH; Agamous-like MADS-box protein AGL62
TrEMBLA0A067EEZ41e-166A0A067EEZ4_CITSI; Uncharacterized protein
STRINGXP_006487058.11e-163(Citrus sinensis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM8628390
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.13e-71AGAMOUS-like 62
Publications ? help Back to Top
  1. Xu W, et al.
    Endosperm and Nucellus Develop Antagonistically in Arabidopsis Seeds.
    Plant Cell, 2016. 28(6): p. 1343-60
    [PMID:27233529]
  2. Figueiredo DD,Batista RA,Roszak PJ,Köhler C
    Auxin production couples endosperm development to fertilization.
    Nat Plants, 2015. 1: p. 15184
    [PMID:27251719]
  3. Figueiredo DD,Batista RA,Roszak PJ,Hennig L,Köhler C
    Auxin production in the endosperm drives seed coat development in Arabidopsis.
    Elife, 2017.
    [PMID:27848912]
  4. Fiume E,Coen O,Xu W,Lepiniec L,Magnani E
    Growth of the Arabidopsis sub-epidermal integument cell layers might require an endosperm signal.
    Plant Signal Behav, 2017. 12(8): p. e1339000
    [PMID:28613109]
  5. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]