PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g039589m
Common NameCISIN_1g039589mg, LOC102609237
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family LBD
Protein Properties Length: 297aa    MW: 32658.8 Da    PI: 7.4129
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g039589mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260137.26e-4371061100
             DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlka 92 
                        +CaaCk+lrrkC+++Cv+apyfp +qp+kfanvhk+FGasnv kll++l ++ reda++sl+yeAear+rdPvyG+vg+i+ lq++l+q+++
  orange1.1g039589m   7 PCAACKFLRRKCTQECVFAPYFPPDQPQKFANVHKVFGASNVAKLLNELATNLREDAVNSLAYEAEARLRDPVYGCVGLISILQHRLKQVQS 98 
                        7******************************************************************************************* PP

             DUF260  93 elallkee 100
                        +l ++k+e
  orange1.1g039589m  99 DLYSAKKE 106
                        **999887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.366107IPR004883Lateral organ boundaries, LOB
PfamPF031951.2E-427104IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009954Biological Processproximal/distal pattern formation
GO:0009965Biological Processleaf morphogenesis
GO:0048441Biological Processpetal development
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MSSSNSPCAA CKFLRRKCTQ ECVFAPYFPP DQPQKFANVH KVFGASNVAK LLNELATNLR  60
EDAVNSLAYE AEARLRDPVY GCVGLISILQ HRLKQVQSDL YSAKKELATY IGPQAMMPML  120
QAQAFMPQQH LGNPSSSTVI QHGMVPMMGI PTGSSHSGQL VIRDPQHQHQ HNQQQQQMFE  180
AQQLAAAVAA KEQQEMLRSY EQQQELVRFN SGFDAPTGFN NQMSGGTMSP SLALGGFDNS  240
YQIQAQQQPA EHHHHHATAH PLQAQLLQQQ PPPPPQTQQQ QKSPSEEGRS IGGPSC*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006425834.10.0hypothetical protein CICLE_v10027275mg
RefseqXP_015389383.10.0PREDICTED: LOB domain-containing protein 36
SwissprotQ9FKZ36e-91LBD36_ARATH; LOB domain-containing protein 36
TrEMBLA0A067DDH10.0A0A067DDH1_CITSI; Uncharacterized protein
TrEMBLV4UIA80.0V4UIA8_9R
STRINGPOPTR_0007s11460.11e-114(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM80082441
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.15e-86ASYMMETRIC LEAVES 2-like 1