PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g039547m
Common NameCISIN_1g039547mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family MYB_related
Protein Properties Length: 68aa    MW: 7935.14 Da    PI: 10.3196
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g039547mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding23.21.6e-07138847
                       HHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding  8 EdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                       Ed l+ ++++   ++ W+ Ia++++ gRt+++  +++ + 
  orange1.1g039547m  1 EDRLICRLFAISESR-WSVIAAHLP-GRTDNETNNYYKNT 38
                       788899999999999.*********.******99999997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd001676.26E-5139No hitNo description
PROSITE profilePS5129410.809143IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.3E-11137IPR009057Homeodomain-like
SuperFamilySSF466898.58E-8142IPR009057Homeodomain-like
PfamPF002493.8E-6138IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 68 aa     Download sequence    Send to blast
EDRLICRLFA ISESRWSVIA AHLPGRTDNE TNNYYKNTKL KRKHEEGGLM VPMKKNLERD  60
LRIVKNH*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015380805.13e-29transcription factor MYB34-like
TrEMBLA0A067FHS32e-42A0A067FHS3_CITSI; Uncharacterized protein (Fragment)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23000.14e-14myb domain protein 37