PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g039494m
Common NameCISIN_1g039494mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family M-type_MADS
Protein Properties Length: 141aa    MW: 15934.3 Da    PI: 10.4637
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g039494mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF33.64.9e-11248147
                       S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEE CS
             SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgkly 47
                       k+ien+  r +tfskR  gi  K +EL +L+   +a ++fs++gk +
  orange1.1g039494m  2 KKIENEDGRLITFSKRTSGIYRKVSELVTLTVSAIARLVFSQSGKPF 48
                       68******************************************965 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006617.395154IPR002100Transcription factor, MADS-box
SMARTSM004328.6E-9153IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.27E-15170IPR002100Transcription factor, MADS-box
PfamPF003199.6E-15350IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 141 aa     Download sequence    Send to blast
MKKIENEDGR LITFSKRTSG IYRKVSELVT LTVSAIARLV FSQSGKPFSF GNPSIEAVAN  60
RFLGLNCQMR KRKETQPRWW ETPVYEFNHQ ELLQMDATID NLSRTFIAKL NEKTAAASSS  120
AAPPMYFHHG LGSFPMQFRS *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006421340.21e-101agamous-like MADS-box protein AGL61
TrEMBLA0A067DJM01e-101A0A067DJM0_CITSI; Uncharacterized protein
STRINGXP_006492957.11e-101(Citrus sinensis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM8628390
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24840.12e-20AGAMOUS-like 61