PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g038848m
Common NameCISIN_1g038848mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family M-type_MADS
Protein Properties Length: 447aa    MW: 48619.6 Da    PI: 8.2099
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g038848mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF44.51.9e-141152344
                       --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTS CS
             SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstg 44
                       i n+s r+ ++ kR+ g+lKK +EL +LCd+++ +ii+s++ 
  orange1.1g038848m 11 IANDSARKASLKKRKVGLLKKVSELTTLCDVNAFIIIYSPDE 52
                       89*************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004329.0E-20160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006616.329149IPR002100Transcription factor, MADS-box
CDDcd002661.37E-27285No hitNo description
SuperFamilySSF554558.76E-22294IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-6323IPR002100Transcription factor, MADS-box
PfamPF003199.3E-141152IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-62338IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-63859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 447 aa     Download sequence    Send to blast
MTRKKVKLNW IANDSARKAS LKKRKVGLLK KVSELTTLCD VNAFIIIYSP DESEPAMWPS  60
RPVVEQLLAR FNNMPEMEKS KKMMNQETYL KERVVKSQDQ LKKNSRKNKV MEVSNLMEQF  120
HLGKKTDDFN INELQGLVWL MEERKKDLRK RMDYYEQINP PPQESLPPPP HPPQLPAPED  180
STAGVGGSTG GGGRNLTESA QWDQWFIDMM KNSENIAGSS SGRTKSDAGS ASHQAFAASS  240
GAANQMGLPH GNPRAYNIGS DLGLPHVNPR AYNIGSDLGL PHVNPRAYNI GSDLGLPHVN  300
PRAYNIGSDL ELPHANPRAY DVGSDLELPH VNPRAYDVGS DLGLPHGSPR AYNIGSDLRL  360
PCGNPRAYNI GSGLGLPQGN INIGSSSSLG GNDVNLGLRQ ENTGVASTAA SSDMGLSSEL  420
FGGSIPGSDV GMPYDVTKQW PHNFYP*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1224RKKVKLNWIANDSARKASLKKRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006430045.10.0uncharacterized protein LOC18038065
TrEMBLA0A067FTE30.0A0A067FTE3_CITSI; Uncharacterized protein
STRINGXP_006430045.10.0(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48670.11e-31AGAMOUS-like 80