PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g038783m
Common NameCISIN_1g038783mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family M-type_MADS
Protein Properties Length: 76aa    MW: 8754.06 Da    PI: 10.3463
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g038783mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF102.91.1e-322575151
                       S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
             SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                       krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyey++
  orange1.1g038783m 25 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYAN 75
                       79***********************************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.4E-411776IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.5431776IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.79E-301875IPR002100Transcription factor, MADS-box
CDDcd002656.07E-391876No hitNo description
PROSITE patternPS0035001973IPR002100Transcription factor, MADS-box
PRINTSPR004044.4E-341939IPR002100Transcription factor, MADS-box
PfamPF003197.2E-282673IPR002100Transcription factor, MADS-box
PRINTSPR004044.4E-343954IPR002100Transcription factor, MADS-box
PRINTSPR004044.4E-345475IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 76 aa     Download sequence    Send to blast
MEFPKQNPES SSQSKKIGRG KIEIKRIENT TNRQVTFCKR RNGLLKKAYE LSVLCDAEVA  60
LIVFSSRGRL YEYANN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P1e-211776160Myocyte-specific enhancer factor 2B
1tqe_Q1e-211776160Myocyte-specific enhancer factor 2B
1tqe_R1e-211776160Myocyte-specific enhancer factor 2B
1tqe_S1e-211776160Myocyte-specific enhancer factor 2B
6c9l_A1e-211776160Myocyte-specific enhancer factor 2B
6c9l_B1e-211776160Myocyte-specific enhancer factor 2B
6c9l_C1e-211776160Myocyte-specific enhancer factor 2B
6c9l_D1e-211776160Myocyte-specific enhancer factor 2B
6c9l_E1e-211776160Myocyte-specific enhancer factor 2B
6c9l_F1e-211776160Myocyte-specific enhancer factor 2B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Csi.25801e-127flower| fruit| vegetative meristem
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed exclusively in stamens and carpels.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in regulating genes that determines stamen and carpel development in wild-type flowers. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2186131e-122AB218613.1 Citrus unshiu CitMADS6 mRNA for MADS-box protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006437205.22e-48agamous-like MADS-box protein AGL5 isoform X2
RefseqXP_024956880.12e-48agamous-like MADS-box protein AGL5
SwissprotQ408852e-38AG_PETHY; Floral homeotic protein AGAMOUS
TrEMBLA0A067F4702e-48A0A067F470_CITSI; Uncharacterized protein (Fragment)
TrEMBLA0A2H5PEJ01e-46A0A2H5PEJ0_CITUN; Uncharacterized protein
TrEMBLA0A2P0ZW217e-47A0A2P0ZW21_CITSI; MADS6 protein
TrEMBLQ05KK07e-47Q05KK0_CITUN; MADS-box protein
TrEMBLV4TKW43e-48V4TKW4_9ROSI; Uncharacterized protein
STRINGXP_006484831.11e-47(Citrus sinensis)
STRINGXP_006437206.14e-49(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7828413
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G09960.27e-30MIKC_MADS family protein
Publications ? help Back to Top
  1. Immink RG, et al.
    Analysis of the petunia MADS-box transcription factor family.
    Mol. Genet. Genomics, 2003. 268(5): p. 598-606
    [PMID:12589434]