PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g038601m
Common NameCISIN_1g038601mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family MYB_related
Protein Properties Length: 200aa    MW: 21793.7 Da    PI: 10.6067
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g038601mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.82.4e-13122166347
                        SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        +WT+eE+  ++ + ++lG g+W+ I++ + ++Rt+ q+ s+ qky
  orange1.1g038601m 122 PWTEEEHRVFLMGLEKLGRGDWRGISKNFVTTRTPTQVASHAQKY 166
                        8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501588.73318IPR001878Zinc finger, CCHC-type
Gene3DG3DSA:4.10.60.102.8E-4331IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129418.069115171IPR017930Myb domain
SuperFamilySSF466891.0E-18117173IPR009057Homeodomain-like
TIGRFAMsTIGR015577.3E-19118170IPR006447Myb domain, plants
SMARTSM007171.6E-10119169IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.9E-12119166IPR009057Homeodomain-like
PfamPF002493.6E-11122166IPR001005SANT/Myb domain
CDDcd001671.55E-9122167No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 200 aa     Download sequence    Send to blast
MGRKCSHCGN TGHNSRTCSS YDNNLKGGSC STSTLAGGLR LFGVQLAISS NSSSSSSSQL  60
LPLKKSLSTD SFPAIPSPSS SASSSSSTGV TINIDQHSNK LSNGYISDSL IAPTQDRKKG  120
VPWTEEEHRV FLMGLEKLGR GDWRGISKNF VTTRTPTQVA SHAQKYFLRQ KNLYKRKRRP  180
SLFDVMPWAW FLLVLLGLY*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006450815.11e-132transcription factor MYBS3
TrEMBLA0A067GX641e-143A0A067GX64_CITSI; Uncharacterized protein
STRINGXP_006450815.11e-131(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM54962747
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56840.18e-45MYB_related family protein