PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g038129m
Common NameCISIN_1g038129mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family LBD
Protein Properties Length: 119aa    MW: 13276.3 Da    PI: 7.7578
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g038129mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260124.26.8e-3911001100
             DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlka 92 
                        +CaaC++lrr+C++dC++apyfpa++p++fa+vhk++G s+v ++l++lp e r +a+++++ eAe+r++dPvyG+v++i+ lqqq++++++
  orange1.1g038129m   1 RCAACRHLRRRCPSDCIFAPYFPANDPHRFACVHKIYGSSKVGNMLQDLPVELRAEAADAICIEAECRVQDPVYGCVRMISLLQQQIHNAES 92 
                        6******************************************************************************************* PP

             DUF260  93 elallkee 100
                        +l+++++e
  orange1.1g038129m  93 QLVKARAE 100
                        ***99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031952.5E-38198IPR004883Lateral organ boundaries, LOB
PROSITE profilePS5089123.3291101IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016020Cellular Componentmembrane
Sequence ? help Back to Top
Protein Sequence    Length: 119 aa     Download sequence    Send to blast
RCAACRHLRR RCPSDCIFAP YFPANDPHRF ACVHKIYGSS KVGNMLQDLP VELRAEAADA  60
ICIEAECRVQ DPVYGCVRMI SLLQQQIHNA ESQLVKARAE IAVLGSHAQE LRHHVQDI*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00381DAPTransfer from AT3G26620Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006490469.15e-83PREDICTED: LOB domain-containing protein 23-like
SwissprotP594674e-48LBD23_ARATH; LOB domain-containing protein 23
SwissprotP594685e-48LBD24_ARATH; LOB domain-containing protein 24
TrEMBLA0A067EYB72e-82A0A067EYB7_CITSI; Uncharacterized protein (Fragment)
STRINGPOPTR_0012s13910.15e-53(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26620.19e-32LOB domain-containing protein 23