PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g038013m
Common NameCISIN_1g038013mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family Dof
Protein Properties Length: 495aa    MW: 54778.5 Da    PI: 7.961
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g038013mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof126.96.1e-40144204262
             zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                        ++k+l+cprC+s++tkfCyynny+++qPr+fCk+C+ryWt+GG++rnvPvG+grrknk+ss
  orange1.1g038013m 144 PDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGTMRNVPVGAGRRKNKSSS 204
                        7899******************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074785.0E-31141201IPR003851Zinc finger, Dof-type
PfamPF027012.7E-32146202IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.947148202IPR003851Zinc finger, Dof-type
PROSITE patternPS013610150186IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 495 aa     Download sequence    Send to blast
MSEVKDSAIK LFGQMIPLSL LKFQQQQGPE TLANDHSASD DDHHQEACCD RNPETALREE  60
SSNKQQQQQQ QQQQRDDKEH SGQQIIEDEH EDVTSKQKDP ITSSGNSDNP KTLSVDRETR  120
SLKSSKNGEQ SETSNSQEKT LKKPDKILPC PRCNSMDTKF CYYNNYNVNQ PRHFCKNCQR  180
YWTAGGTMRN VPVGAGRRKN KSSSASNYRQ IMISEALRTF QANASGGVYK PYSGNNGTIL  240
TFGSDSPLHE SVASVPNLSD KSQNCLRNGF HRSEQKILVS GTDNGSSITA SSSLEKGGNC  300
TSQDIRTKNY RGSVPQVPYF PGPPWPHHWN TPMPPPGFYP SGFPVSFYPE TTYWGCAVPG  360
YCNMPCVPPN ASLQSQFVPK TLSTPTLGKH SRDGDIITPA STEKEEPSTG SRNSERCVLV  420
PKTLRIDDPS EAAKSSIWAT LGIKNEKTTS AGECLFKGFQ SKSDHRNYIA ETSEVLQANP  480
AALSRSLNFH ERHN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006483138.10.0PREDICTED: cyclic dof factor 3-like
TrEMBLA0A067GTJ00.0A0A067GTJ0_CITSI; Uncharacterized protein
STRINGPOPTR_0008s08740.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM54412848
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.22e-93cycling DOF factor 2