PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g037591m
Common NameCISIN_1g037591mg, LOC102616408
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family NAC
Protein Properties Length: 332aa    MW: 37052.8 Da    PI: 8.7666
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g037591mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1782.5e-55101371128
                NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                        lppGfrFhP+deel+++yL +k+++ +++  ++i++vd++k+ePwdLp k+k +ekewyfFs rd+ky+tg r+nrat++gyWk+tgkdke+
  orange1.1g037591m  10 LPPGFRFHPSDEELITYYLVNKISDASFTG-RAIADVDLNKCEPWDLPGKAKMGEKEWYFFSLRDRKYPTGVRTNRATNTGYWKTTGKDKEI 100
                        79*************************999.89***************99999*************************************** PP

                NAM  93 lsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                        +++ ++elvg+kktLvfy+grap+gekt+Wvmheyr+
  orange1.1g037591m 101 FNSvTSELVGMKKTLVFYRGRAPRGEKTNWVMHEYRI 137
                        *9989999***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.75E-648158IPR003441NAC domain
PROSITE profilePS5100560.91710158IPR003441NAC domain
PfamPF023652.6E-2811137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 332 aa     Download sequence    Send to blast
MEGDKKEETL PPGFRFHPSD EELITYYLVN KISDASFTGR AIADVDLNKC EPWDLPGKAK  60
MGEKEWYFFS LRDRKYPTGV RTNRATNTGY WKTTGKDKEI FNSVTSELVG MKKTLVFYRG  120
RAPRGEKTNW VMHEYRIHSK SAFRTSKDEW VVCRVFQKSA GAKKFPTNQS RAVNPAYNLD  180
IGASVIPPQM IQAENFQFPV GRNYTGNADQ LAEFTRMFRG GASSSVNNNF PIQSQMNYPL  240
AGGFTISGLN LNLGGATTQP VLRPMPPPPP HPQAMHQEEV TCSMMTSSAY AADQSLTGYA  300
AEINQANGAA GGSRYMSLEH CMDLDSYWPP Y*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-56916416171NO APICAL MERISTEM PROTEIN
1ut4_B2e-56916416171NO APICAL MERISTEM PROTEIN
1ut7_A2e-56916416171NO APICAL MERISTEM PROTEIN
1ut7_B2e-56916416171NO APICAL MERISTEM PROTEIN
3swm_A2e-56916419174NAC domain-containing protein 19
3swm_B2e-56916419174NAC domain-containing protein 19
3swm_C2e-56916419174NAC domain-containing protein 19
3swm_D2e-56916419174NAC domain-containing protein 19
3swp_A2e-56916419174NAC domain-containing protein 19
3swp_B2e-56916419174NAC domain-containing protein 19
3swp_C2e-56916419174NAC domain-containing protein 19
3swp_D2e-56916419174NAC domain-containing protein 19
4dul_A2e-56916416171NAC domain-containing protein 19
4dul_B2e-56916416171NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00277DAPTransfer from AT2G24430Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006450119.10.0protein CUP-SHAPED COTYLEDON 1
RefseqXP_006483615.10.0protein CUP-SHAPED COTYLEDON 1
TrEMBLA0A067FUX40.0A0A067FUX4_CITSI; Uncharacterized protein
TrEMBLA0A2H5NWK30.0A0A2H5NWK3_CITUN; Uncharacterized protein
TrEMBLV4WAJ80.0V4WAJ8_9ROSI; Uncharacterized protein
STRINGXP_006483615.10.0(Citrus sinensis)
STRINGXP_006450119.10.0(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM68512841
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24430.21e-118NAC domain containing protein 38