PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g037442m
Common NameCISIN_1g037442mg, LOC102615185
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family M-type_MADS
Protein Properties Length: 181aa    MW: 20260.4 Da    PI: 8.7159
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g037442mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF66.13.5e-211053245
                       ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
             SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                        ++++  rqvtfskRrng++KKA+EL +LC+a +a+++fs+ gk
  orange1.1g037442m 10 MVKDSNSRQVTFSKRRNGLFKKANELATLCAAHIAIVVFSPGGK 53
                       5789999**********************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554554.58E-27172IPR002100Transcription factor, MADS-box
PROSITE profilePS5006626.198161IPR002100Transcription factor, MADS-box
SMARTSM004326.5E-34160IPR002100Transcription factor, MADS-box
CDDcd002651.02E-32271No hitNo description
PRINTSPR004043.6E-20323IPR002100Transcription factor, MADS-box
PfamPF003191.5E-241157IPR002100Transcription factor, MADS-box
PRINTSPR004043.6E-202338IPR002100Transcription factor, MADS-box
PRINTSPR004043.6E-203859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 181 aa     Download sequence    Send to blast
MGRRKIEMKM VKDSNSRQVT FSKRRNGLFK KANELATLCA AHIAIVVFSP GGKPFSFGHP  60
SVDVVVQRLL NWEMDPKDET NSHVDAEQEA KVEQLNEQLI DLVNQLEIEK KRGEMLDKAL  120
KAKGLSKYCK KSINDLGLDE LLHMKASLEK LRENLKSHID DMEASSSLLL LKGATKENDG  180
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A8e-16198191MEF2C
5f28_B8e-16198191MEF2C
5f28_C8e-16198191MEF2C
5f28_D8e-16198191MEF2C
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: During embryogenesis, expressed in the chalazal endosperm. {ECO:0000269|PubMed:20631316}.
UniprotTISSUE SPECIFICITY: Expressed in pollen. {ECO:0000269|PubMed:12949148}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006468192.21e-129agamous-like MADS-box protein AGL29
SwissprotO647032e-47AGL29_ARATH; Agamous-like MADS-box protein AGL29
TrEMBLA0A067GET81e-128A0A067GET8_CITSI; Uncharacterized protein
STRINGXP_006468192.11e-129(Citrus sinensis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM8628390
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34440.19e-50AGAMOUS-like 29
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]