PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g036664m
Common NameCISIN_1g036664mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family LBD
Protein Properties Length: 226aa    MW: 25831.7 Da    PI: 7.2079
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g036664mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260117.58.3e-37241231100
             DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlka 92 
                        aCa+Ck++rrkC+k+C la+yfpa+qpk+f+nvh+l+G+s vlk+l++++++++++ams++++e+++ra+ Pv+G++g+ ++l++ql+ + +
  orange1.1g036664m  24 ACAVCKYQRRKCEKNCKLAKYFPANQPKTFQNVHRLYGVSSVLKILDSVEDDKKDIAMSTVIFESNMRAEYPVHGCFGLTFRLHHQLQASME 115
                        7******************************************************************************************* PP

             DUF260  93 elallkee 100
                        el l++++
  orange1.1g036664m 116 ELRLVNAQ 123
                        ***99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.33923124IPR004883Lateral organ boundaries, LOB
PfamPF031954.6E-3424121IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    Send to blast
KLFFILCLVP SLIKMTIKGG TKQACAVCKY QRRKCEKNCK LAKYFPANQP KTFQNVHRLY  60
GVSSVLKILD SVEDDKKDIA MSTVIFESNM RAEYPVHGCF GLTFRLHHQL QASMEELRLV  120
NAQLAGNEFC VETDDDVKPF IKIEQNPNYY TDMFNNMPLG IQSPSSSHGI PIPLQELECI  180
NSIHDDRVMA FDHTIPDHDR NPYLEPKAKE VSDASRYIID CHIRY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A9e-21201247111LOB family transfactor Ramosa2.1
5ly0_B9e-21201247111LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006482664.21e-149LOB domain-containing protein 3-like
SwissprotQ9STS63e-38LBD27_ARATH; LOB domain-containing protein 27
TrEMBLA0A067FYF11e-168A0A067FYF1_CITSI; Uncharacterized protein (Fragment)
STRINGXP_006431057.11e-144(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63032746
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.11e-40LOB domain-containing protein 27
Publications ? help Back to Top
  1. Kim MJ,Kim M,Kim J
    Combinatorial interactions between LBD10 and LBD27 are essential for male gametophyte development in Arabidopsis.
    Plant Signal Behav, 2015. 10(8): p. e1044193
    [PMID:26252070]
  2. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]