PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g036653m
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family WRKY
Protein Properties Length: 488aa    MW: 53543.5 Da    PI: 6.4662
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g036653mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY78.66.9e-25174230259
                        --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
               WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                        +DgynWrKYGqK+vk+ + +rsYY+Ct+++C++kk +e+s++ ++v+ei+++g H h+
  orange1.1g036653m 174 SDGYNWRKYGQKQVKSPKGSRSYYKCTYSDCCAKK-IECSDHSGHVIEIVNKGMHSHD 230
                        8********************************98.*********************7 PP

2WRKY98.73.8e-31350406359
                        -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
               WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                        Dgy+WrKYGqK+vkg+++pr+YYrCtsagCpv+k++e++ +++++v+itY+g H+h+
  orange1.1g036653m 350 DGYRWRKYGQKMVKGNPNPRNYYRCTSAGCPVRKHIETAVDNTSAVIITYKGVHDHD 406
                        9*******************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.3E-19167232IPR003657WRKY domain
SuperFamilySSF1182902.75E-19170232IPR003657WRKY domain
SMARTSM007747.7E-23173231IPR003657WRKY domain
PROSITE profilePS5081116.926174232IPR003657WRKY domain
PfamPF031064.1E-16175229IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.3E-31333408IPR003657WRKY domain
PROSITE profilePS5081131.927343408IPR003657WRKY domain
SuperFamilySSF1182906.67E-27344408IPR003657WRKY domain
SMARTSM007742.5E-35348407IPR003657WRKY domain
PfamPF031061.8E-23350405IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 488 aa     Download sequence    Send to blast
MAESESFEAR KRHENPQNDE FEEEEEEEDE EILDDEEEDE GASQLTEPHQ LQLTENNKHH  60
KGLQVNSGVE SNEGTKLKEQ VEVSHHEGSG SIAVQAAESQ TQYQLQPSIC PTSLSELSPT  120
SVTEPISSAP SPTLTGQNLS LVKVDTASVP EANLQTSSEL KNVSVVHIVK TPVSDGYNWR  180
KYGQKQVKSP KGSRSYYKCT YSDCCAKKIE CSDHSGHVIE IVNKGMHSHD PPRKNNCVRE  240
SRLISSVGPV IGNNITEQSL RMLNDSVPST SSKDSVRDSN LVPERKRPNL SSFAGDGEVS  300
VKEEHPSEPE PKRRQSEERQ PSKFKPSFLK PGKKPKFVVH AAGDVGISGD GYRWRKYGQK  360
MVKGNPNPRN YYRCTSAGCP VRKHIETAVD NTSAVIITYK GVHDHDMPVP KKRHGPPSAP  420
LVAAAAPASM NNLQLKKTDA VQNQTTSTQW SVRTEGELAG AAMDLGGEKA MESARTLLSI  480
GFEIKPC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A9e-26336408274WRKY transcription factor 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Csi.109170.0fruit
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX2360330.0JX236033.1 Citrus trifoliata WRKY2 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006453624.10.0hypothetical protein CICLE_v10008135mg
RefseqXP_015384576.10.0PREDICTED: probable WRKY transcription factor 32 isoform X1
SwissprotP595831e-140WRK32_ARATH; Probable WRKY transcription factor 32
TrEMBLV4WJB70.0V4WJB7_9R
STRINGVIT_11s0037g00150.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63382844
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G30935.11e-132WRKY DNA-binding protein 32