PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g036058m
Common NameCISIN_1g036058mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family M-type_MADS
Protein Properties Length: 81aa    MW: 9288.09 Da    PI: 10.7524
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g036058mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF77.11.3e-24955147
                       S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEE CS
             SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgkly 47
                       k+ien + r++tf+kR+ g+ KKA+E+S+LCd+eva+iifs+ gkl 
  orange1.1g036058m  9 KKIENRTYRHITFAKRKSGLVKKAYEISTLCDVEVALIIFSPAGKLI 55
                       78*******************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006626.562161IPR002100Transcription factor, MADS-box
SMARTSM004321.0E-29160IPR002100Transcription factor, MADS-box
SuperFamilySSF554556.67E-26278IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004046.2E-23323IPR002100Transcription factor, MADS-box
PfamPF003192.5E-231055IPR002100Transcription factor, MADS-box
PRINTSPR004046.2E-232338IPR002100Transcription factor, MADS-box
PRINTSPR004046.2E-233859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 81 aa     Download sequence    Send to blast
MGRVRLQIKK IENRTYRHIT FAKRKSGLVK KAYEISTLCD VEVALIIFSP AGKLILFDGK  60
KRLDEILMHF IDLPHHQRAA *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P2e-18179180Myocyte-specific enhancer factor 2B
1tqe_Q2e-18179180Myocyte-specific enhancer factor 2B
1tqe_R2e-18179180Myocyte-specific enhancer factor 2B
1tqe_S2e-18179180Myocyte-specific enhancer factor 2B
5f28_A2e-18179180MEF2C
5f28_B2e-18179180MEF2C
5f28_C2e-18179180MEF2C
5f28_D2e-18179180MEF2C
6c9l_A2e-18179180Myocyte-specific enhancer factor 2B
6c9l_B2e-18179180Myocyte-specific enhancer factor 2B
6c9l_C2e-18179180Myocyte-specific enhancer factor 2B
6c9l_D2e-18179180Myocyte-specific enhancer factor 2B
6c9l_E2e-18179180Myocyte-specific enhancer factor 2B
6c9l_F2e-18179180Myocyte-specific enhancer factor 2B
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in pollen. {ECO:0000269|PubMed:12949148}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that forms heterodimers with the MADS-box proteins AGL30 and AGL65 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012491910.12e-39PREDICTED: MADS-box transcription factor 7-like
SwissprotQ9LM461e-28AG104_ARATH; Agamous-like MADS-box protein AGL104
TrEMBLA0A067GUQ03e-51A0A067GUQ0_CITSI; Uncharacterized protein
STRINGGorai.007G219600.16e-39(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7828413
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22130.15e-31AGAMOUS-like 104
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]