PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g035911m
Common NameCISIN_1g035911mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family TCP
Protein Properties Length: 263aa    MW: 29907 Da    PI: 9.652
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g035911mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP136.22.7e-42561933133
                TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgt...........ssssaseceaesssssas 83 
                         kkdrhski T++g+RdRR+Rls+++a++fFdLqd+LG+dk+skt+eWL+ qakp+ik+l +            +++  sec    ++++  
  orange1.1g035911m  56 SKKDRHSKINTAKGPRDRRMRLSLDVARKFFDLQDMLGYDKASKTVEWLMIQAKPEIKKLIERclpevnccgdvGAKGTSEC----EVEAII 143
                        69*************************************************************4444444444433333444....233333 PP

                TCP  84 nsssgkaaksaakskksqksaasalnlakesrakarararertrekmrik 133
                         +s++ ++k + k+kk ++s +  + lak+ r+karararert +km  +
  orange1.1g035911m 144 DNSAAIRRKISVKEKKIKHSRKIIRPLAKDLREKARARARERTCKKMWSR 193
                        444445566666999999999999**********************9765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036346.6E-3956192IPR005333Transcription factor, TCP
PROSITE profilePS5136935.13957115IPR017887Transcription factor TCP subgroup
PROSITE profilePS5137010.265172189IPR017888CYC/TB1, R domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:2000032Biological Processregulation of secondary shoot formation
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 263 aa     Download sequence    Send to blast
HQPLTPDPDD STLPELLVNM VDSSNSEANG LTKDCSVRNQ DVISNRQMPI SKRSSSKKDR  60
HSKINTAKGP RDRRMRLSLD VARKFFDLQD MLGYDKASKT VEWLMIQAKP EIKKLIERCL  120
PEVNCCGDVG AKGTSECEVE AIIDNSAAIR RKISVKEKKI KHSRKIIRPL AKDLREKARA  180
RARERTCKKM WSREFDHVPK LQADEPEKNE LISFGSKSSF GARDTKTQDK NHSLEVLADQ  240
VEEPSSQEQP HQFADFQYFG KQ*
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Detected in axillary mersitems which appears in the axils of leaves after flowering. During bud vegetative development, down-regulated in the outer layers of the meristem, but accumulates transiently in young leaf primordia. In buds bearing flowers, restricted to the provascular tissue underlying the bud. Accumulates in axillary buds, but disappears at the time of bud outgrowth. {ECO:0000269|PubMed:17307924}.
UniprotTISSUE SPECIFICITY: Expressed in unelongated axillary buds, and, to a lower extent, in axillary structures such as flowers and siliques. {ECO:0000269|PubMed:17307924, ECO:0000269|PubMed:17452340}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that prevents axillary bud outgrowth and delays early axillary bud development. Indirectly required for the auxin-induced control of apical dominance. {ECO:0000269|PubMed:17307924, ECO:0000269|PubMed:17452340}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced during environmentally induced bud dormancy (planting density). Repressed transiently after shoot apical meristem (SAM) decapitation (release from apical dominance). {ECO:0000269|PubMed:17307924}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015388047.10.0transcription factor CYCLOIDEA-like
SwissprotA1YKT11e-27TCP18_ARATH; Transcription factor TCP18
TrEMBLA0A067FAZ50.0A0A067FAZ5_CITSI; Uncharacterized protein (Fragment)
STRINGXP_006485748.10.0(Citrus sinensis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM72692742
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68800.13e-22TCP domain protein 12
Publications ? help Back to Top
  1. Lewis JM, et al.
    Overexpression of the maize Teosinte Branched1 gene in wheat suppresses tiller development.
    Plant Cell Rep., 2008. 27(7): p. 1217-25
    [PMID:18392625]
  2. Niwa M,Endo M,Araki T
    Florigen is involved in axillary bud development at multiple stages in Arabidopsis.
    Plant Signal Behav, 2013. 8(11): p. e27167
    [PMID:24305631]
  3. González-Grandío E,Cubas P
    Identification of gene functions associated to active and dormant buds in Arabidopsis.
    Plant Signal Behav, 2014. 9(2): p. e27994
    [PMID:24518068]
  4. Stes E, et al.
    Strigolactones as an auxiliary hormonal defence mechanism against leafy gall syndrome in Arabidopsis thaliana.
    J. Exp. Bot., 2015. 66(16): p. 5123-34
    [PMID:26136271]
  5. Yao C,Finlayson SA
    Abscisic Acid Is a General Negative Regulator of Arabidopsis Axillary Bud Growth.
    Plant Physiol., 2015. 169(1): p. 611-26
    [PMID:26149576]
  6. González-Grandío E, et al.
    Abscisic acid signaling is controlled by a BRANCHED1/HD-ZIP I cascade in Arabidopsis axillary buds.
    Proc. Natl. Acad. Sci. U.S.A., 2017. 114(2): p. E245-E254
    [PMID:28028241]
  7. Seale M,Bennett T,Leyser O
    BRC1 expression regulates bud activation potential but is not necessary or sufficient for bud growth inhibition in Arabidopsis.
    Development, 2017. 144(9): p. 1661-1673
    [PMID:28289131]
  8. Otori K,Tamoi M,Tanabe N,Shigeoka S
    Enhancements in sucrose biosynthesis capacity affect shoot branching in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2017. 81(8): p. 1470-1477
    [PMID:28471323]
  9. Lantzouni O,Klermund C,Schwechheimer C
    Largely additive effects of gibberellin and strigolactone on gene expression in Arabidopsis thaliana seedlings.
    Plant J., 2017. 92(5): p. 924-938
    [PMID:28977719]
  10. Yang Y, et al.
    The TIE1 transcriptional repressor controls shoot branching by directly repressing BRANCHED1 in Arabidopsis.
    PLoS Genet., 2018. 14(3): p. e1007296
    [PMID:29570704]