PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g034546m
Common NameCISIN_1g034546mg, LOC102613816
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family MYB_related
Protein Properties Length: 92aa    MW: 11108.7 Da    PI: 10.0957
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g034546mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding25.33.5e-083170445
                       S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
    Myb_DNA-binding  4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                       ++++E++l+++  k+ G + W++Ia +++ gR ++++  +w 
  orange1.1g034546m 31 MSEQEEDLIYRMYKLVGDR-WALIAGRIP-GRKAEEIERFWI 70
                       79***************99.*********.*********995 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007171.8E-52775IPR001005SANT/Myb domain
CDDcd001672.70E-53069No hitNo description
PfamPF002491.8E-73170IPR001005SANT/Myb domain
SuperFamilySSF466895.07E-73270IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.8E-103270IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010091Biological Processtrichome branching
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 92 aa     Download sequence    Send to blast
MDKRRRKQAK TTTTTFYSEE VSSIEWEFIN MSEQEEDLIY RMYKLVGDRW ALIAGRIPGR  60
KAEEIERFWI MRHGQAFADR RRELRIYNSK S*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
117DKRRRKQ
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Ubiquitous in young leaves. Later, restricted to the leaf base in the trichome initiation zone. In mature leaves, confined to trichome cells. {ECO:0000269|PubMed:12356720}.
UniprotTISSUE SPECIFICITY: Expressed in roots, leaves, siliques and inflorescences. {ECO:0000269|PubMed:12356720}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Involved in epidermal cell fate specification. Negative regulator of trichome development, including endoreplication, by lateral inhibition involving intercellular interactions. Promotes the formation of hair developing cells (trichoblasts) in H position in root epidermis, probably by inhibiting non-hair cell (atrichoblasts) formation. {ECO:0000269|PubMed:10368181, ECO:0000269|PubMed:12356720}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Negative autoregulation. Repressed by CPC. {ECO:0000269|PubMed:12356720}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006444875.14e-61transcription factor CPC
RefseqXP_006491245.14e-61transcription factor CPC
SwissprotQ8GV052e-37TRY_ARATH; Transcription factor TRY
TrEMBLA0A067H3338e-60A0A067H333_CITSI; Uncharacterized protein
TrEMBLA0A2H5PG768e-60A0A2H5PG76_CITUN; Uncharacterized protein
TrEMBLV4U2368e-60V4U236_9ROSI; Uncharacterized protein
STRINGXP_006491245.11e-60(Citrus sinensis)
STRINGXP_006444875.11e-60(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM32328194
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53200.15e-39MYB_related family protein
Publications ? help Back to Top
  1. Perazza D, et al.
    Trichome cell growth in Arabidopsis thaliana can be derepressed by mutations in at least five genes.
    Genetics, 1999. 152(1): p. 461-76
    [PMID:10224275]
  2. Scheres B
    Plant patterning: TRY to inhibit your neighbors.
    Curr. Biol., 2002. 12(23): p. R804-6
    [PMID:12477405]
  3. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  4. Brininstool G, et al.
    Constitutive Expressor Of Pathogenesis-related Genes5 affects cell wall biogenesis and trichome development.
    BMC Plant Biol., 2008. 8: p. 58
    [PMID:18485217]
  5. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  6. Xue XY, et al.
    Interaction between two timing microRNAs controls trichome distribution in Arabidopsis.
    PLoS Genet., 2014. 10(4): p. e1004266
    [PMID:24699192]
  7. Nayidu NK, et al.
    Comparison of five major trichome regulatory genes in Brassica villosa with orthologues within the Brassicaceae.
    PLoS ONE, 2014. 9(4): p. e95877
    [PMID:24755905]
  8. Taheri A, et al.
    A landscape of hairy and twisted: hunting for new trichome mutants in the Saskatoon Arabidopsis T-DNA population.
    Plant Biol (Stuttg), 2015. 17(2): p. 384-94
    [PMID:25348773]
  9. Wada T,Hayashi N,Tominaga-Wada R
    Root hair formation at the root-hypocotyl junction in CPC-LIKE MYB double and triple mutants of Arabidopsis.
    Plant Signal Behav, 2015. 10(11): p. e1089372
    [PMID:26339713]
  10. Wada T,Tominaga-Wada R
    CAPRICE family genes control flowering time through both promoting and repressing CONSTANS and FLOWERING LOCUS T expression.
    Plant Sci., 2015. 241: p. 260-5
    [PMID:26706076]
  11. Tian H, et al.
    NTL8 Regulates Trichome Formation in Arabidopsis by Directly Activating R3 MYB Genes TRY and TCL1.
    Plant Physiol., 2017. 174(4): p. 2363-2375
    [PMID:28649093]
  12. Tominaga-Wada R,Wada T
    Extended C termini of CPC-LIKE MYB proteins confer functional diversity in Arabidopsis epidermal cell differentiation.
    Development, 2017. 144(13): p. 2375-2380
    [PMID:28676568]
  13. Kohanov√° J, et al.
    Root hair abundance impacts cadmium accumulation in Arabidopsis thaliana shoots.
    Ann. Bot., 2018. 122(5): p. 903-914
    [PMID:29394308]
  14. Yamada K,Sasabe M,Fujikawa Y,Wada T,Tominaga-Wada R
    Amino acid substitutions in CPC-LIKE MYB reveal residues important for protein stability in Arabidopsis roots.
    PLoS ONE, 2018. 13(10): p. e0205522
    [PMID:30308079]
  15. Kribii R, et al.
    Cloning and characterization of the Arabidopsis thaliana SQS1 gene encoding squalene synthase--involvement of the C-terminal region of the enzyme in the channeling of squalene through the sterol pathway.
    Eur. J. Biochem., 1997. 249(1): p. 61-9
    [PMID:9363754]