PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g034117m
Common NameCISIN_1g030283mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family YABBY
Protein Properties Length: 104aa    MW: 11154 Da    PI: 11.6304
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g034117mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY262.9e-08189083157
              YABBY  83 ksnvekeesastsvsseklsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaa 157
                        k n+ k    +++ ++ kl++ ++++ +r +++ + P+k +r Psa+  f+ e  +  k +nP+++   a   aa
  orange1.1g034117m  18 KPNDRKVG--KRKAATAKLDSGSKRQGKREKKAKKDPNKPKRPPSAFFVFLEEFRKTFKKENPNVTAVSAVGKAA 90 
                        44444433..455566679999999999999********************999999*********999998877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF470951.83E-1741100IPR009071High mobility group box domain
Gene3DG3DSA:1.10.30.103.9E-145499IPR009071High mobility group box domain
SMARTSM003989.2E-554103IPR009071High mobility group box domain
PROSITE profilePS5011813.17155103IPR009071High mobility group box domain
CDDcd013902.82E-95599No hitNo description
PfamPF005059.0E-1555100IPR009071High mobility group box domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 104 aa     Download sequence    Send to blast
MKGAKGKGAA RVSQEALKPN DRKVGKRKAA TAKLDSGSKR QGKREKKAKK DPNKPKRPPS  60
AFFVFLEEFR KTFKKENPNV TAVSAVGKAA GGKWKSMSPA VSI*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Csi.100671e-166callus
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006481021.17e-65PREDICTED: high mobility group B protein 1-like
RefseqXP_006481020.17e-65PREDICTED: high mobility group B protein 1-like
SwissprotO495953e-39HMGB1_ARATH; High mobility group B protein 1
TrEMBLA0A067DXN25e-66A0A067DXN2_CITSI; Uncharacterized protein
STRINGfgenesh1_pm.C_scaffold_50012812e-37(Arabidopsis lyrata)