PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g032690m
Common NameCISIN_1g032690mg, LOC102625492
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family WRKY
Protein Properties Length: 136aa    MW: 15569.1 Da    PI: 8.817
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g032690mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY70.52.4e-223188259
                       --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
               WRKY  2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
                       +Dgy+W+KYGqK +k+ +  rsY++C  ++C++kk+ e +++dp+ v i+Y g H h+
  orange1.1g032690m 31 EDGYEWKKYGQKFIKNIRKFRSYFKCQESSCMAKKRAEWCTSDPTNVRIVYDGVHSHT 88
                       7********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.808.5E-232588IPR003657WRKY domain
PROSITE profilePS5081118.7282590IPR003657WRKY domain
SuperFamilySSF1182901.83E-212588IPR003657WRKY domain
SMARTSM007741.7E-213089IPR003657WRKY domain
PfamPF031062.1E-193187IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 136 aa     Download sequence    Send to blast
MDYIIHETRD QNDGEDAQEM DRRVHRLVLP EDGYEWKKYG QKFIKNIRKF RSYFKCQESS  60
CMAKKRAEWC TSDPTNVRIV YDGVHSHTHH GSSPSSADQP RRGSSNTSSN GNQYNLLTQV  120
FGDQSSNAPP ASRRN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006488951.11e-100probable WRKY transcription factor 23
RefseqXP_024047358.11e-100probable WRKY transcription factor 23
TrEMBLA0A067EHB32e-98A0A067EHB3_CITSI; Uncharacterized protein
STRINGXP_006488951.13e-99(Citrus sinensis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2398844
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69310.21e-13WRKY DNA-binding protein 57