PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g032310m
Common NameCISIN_1g032310mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family SBP
Protein Properties Length: 144aa    MW: 16034.6 Da    PI: 8.1413
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g032310mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP134.73e-4259135278
                        -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                        Cqve+C+a++++ak+yhrrhkvC++h+kapvv v+gl qrfCqqCsrfhelsefD++krsCrrrLa+hnerrrk++a
  orange1.1g032310m  59 CQVENCRANMTDAKKYHRRHKVCDFHAKAPVVRVEGLAQRFCQQCSRFHELSEFDDTKRSCRRRLAGHNERRRKSSA 135
                        **************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0375751.8E-581143IPR017238Squamosa promoter-binding protein
Gene3DG3DSA:4.10.1100.108.5E-3453120IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.72756133IPR004333Transcription factor, SBP-box
SuperFamilySSF1036126.67E-3957138IPR004333Transcription factor, SBP-box
PfamPF031101.5E-3259132IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009911Biological Processpositive regulation of flower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010229Biological Processinflorescence development
GO:0010321Biological Processregulation of vegetative phase change
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046872Molecular Functionmetal ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 144 aa     Download sequence    Send to blast
MEASRAEGKR SLKEDDQEEE EDDEDSGGGI AGEEDKIKKK GKRGSSSAGA GGPTTFVSCQ  60
VENCRANMTD AKKYHRRHKV CDFHAKAPVV RVEGLAQRFC QQCSRFHELS EFDDTKRSCR  120
RRLAGHNERR RKSSADYHGE GSN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A8e-3649132184squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00290DAPTransfer from AT2G33810Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006467766.21e-100PREDICTED: squamosa promoter-binding-like protein 3
SwissprotQ387416e-52SBP1_ANTMA; Squamosa promoter-binding protein 1
TrEMBLA0A067GG391e-101A0A067GG39_CITSI; Squamosa promoter-binding-like protein
STRINGPOPTR_0001s40870.14e-50(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM86828118
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33810.12e-42squamosa promoter binding protein-like 3