PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g032101m
Common NameCISIN_1g030283mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family YABBY
Protein Properties Length: 148aa    MW: 16152.8 Da    PI: 11.0422
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g032101mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY23.81.3e-07209085157
              YABBY  85 nvekeesastsvsseklsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaa 157
                        n+ k    +++ ++ kl++ ++++ +r +++ + P+k +r Psa+  f+ e  +  k +nP+++   a   aa
  orange1.1g032101m  20 NDRKV--GKRKAATAKLDSGSKRQGKREKKAKKDPNKPKRPPSAFFVFLEEFRKTFKKENPNVTAVSAVGKAA 90 
                        44433..3455566679999999999999********************999999*********999998877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF470953.93E-2641125IPR009071High mobility group box domain
Gene3DG3DSA:1.10.30.104.6E-2553126IPR009071High mobility group box domain
SMARTSM003988.9E-2554125IPR009071High mobility group box domain
PfamPF005051.8E-2455124IPR009071High mobility group box domain
PROSITE profilePS5011819.55855124IPR009071High mobility group box domain
CDDcd000848.36E-1755120No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 148 aa     Download sequence    Send to blast
MKGAKGKGAA RVSQEALKPN DRKVGKRKAA TAKLDSGSKR QGKREKKAKK DPNKPKRPPS  60
AFFVFLEEFR KTFKKENPNV TAVSAVGKAA GGKWKSMSPA EKAPYESKAE KLKSEYGKKM  120
NAYNKKQVTN LVPFFNSVDA FGSLLCV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1j3c_A7e-1749126379High mobility group protein 2
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Csi.100670.0callus
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006481020.12e-84PREDICTED: high mobility group B protein 1-like
RefseqXP_006481021.12e-84PREDICTED: high mobility group B protein 1-like
SwissprotO495952e-51HMGB1_ARATH; High mobility group B protein 1
TrEMBLA0A067DY401e-100A0A067DY40_CITSI; Uncharacterized protein
STRINGfgenesh1_pm.C_scaffold_50012816e-50(Arabidopsis lyrata)