PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g032052m
Common NameCISIN_1g032052mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family M-type_MADS
Protein Properties Length: 149aa    MW: 16350.6 Da    PI: 7.1795
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g032052mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF41.12.3e-132361145
                       HHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
             SRF-TF 11 vtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                       vtfskRr+g++KKA+E    ++ ++av++fs+ g+
  orange1.1g032052m  2 VTFSKRRQGLFKKAQEYANITGSQIAVLVFSPAGN 36
                       9*******************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006615.264144IPR002100Transcription factor, MADS-box
PfamPF003197.9E-16138IPR002100Transcription factor, MADS-box
SMARTSM004325.4E-6243IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.7E-15257IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-5621IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-52142IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 149 aa     Download sequence    Send to blast
MVTFSKRRQG LFKKAQEYAN ITGSQIAVLV FSPAGNPYVH GSPSFDAVID KFLSVNGGAS  60
SSGQVGAHHN EADVCRTPTP FHLVLQNHHN EADVCRGFLM ALEDKIKRCR SAEDLSAVKA  120
ELEEVRVKVL QRLKHIEEDE FVTSLLNC*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015388538.11e-107agamous-like MADS-box protein AGL61
TrEMBLA0A2H5QI521e-106A0A2H5QI52_CITUN; Uncharacterized protein
STRINGXP_006442526.11e-106(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2014436
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34440.19e-17AGAMOUS-like 29