PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g031572m
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family LBD
Protein Properties Length: 158aa    MW: 17473.6 Da    PI: 5.6788
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g031572mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260140.17.1e-4410108199
             DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlka 92 
                        +CaaCk lrrkC +dCv+apyfp e+p+kf nvhk+FGasnv+kll+++ +++reda++sl+yeAear++dPvyG+vg i+ lq+q+++l+ 
  orange1.1g031572m  10 PCAACKCLRRKCMPDCVFAPYFPPEEPQKFVNVHKIFGASNVSKLLNEVLPHQREDAVNSLAYEAEARLKDPVYGCVGAISVLQRQVMRLQR 101
                        7******************************************************************************************* PP

             DUF260  93 elallke 99 
                        el+++++
  orange1.1g031572m 102 ELDATNA 108
                        **99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.0879110IPR004883Lateral organ boundaries, LOB
PfamPF031952.2E-4310107IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 158 aa     Download sequence    Send to blast
MASSSYSNAP CAACKCLRRK CMPDCVFAPY FPPEEPQKFV NVHKIFGASN VSKLLNEVLP  60
HQREDAVNSL AYEAEARLKD PVYGCVGAIS VLQRQVMRLQ RELDATNADL IRYACNEMPP  120
QFGARSDTNE QNSGFYFPSQ WNNNNDGSHE GGESSSM*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006446576.11e-116hypothetical protein CICLE_v10017006mg
SwissprotQ8L8Q32e-68LBD25_ARATH; LOB domain-containing protein 25
TrEMBLV4UC441e-116V4UC44_9R
STRINGPOPTR_0001s35280.12e-88(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27650.19e-70LOB domain-containing protein 25