PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g031482m
Common NameCISIN_1g031482mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family WRKY
Protein Properties Length: 160aa    MW: 18301.1 Da    PI: 5.1038
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g031482mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY99.12.8e-3198156159
                        ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
               WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                        ldDg++WrKYG+K+vk+s++pr+YY+C+  gCpvkk+ver+++dp++v++tYeg H+h+
  orange1.1g031482m  98 LDDGFKWRKYGKKMVKNSPNPRNYYKCSVDGCPVKKRVERDRDDPSYVITTYEGFHTHQ 156
                        59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.1E-3384157IPR003657WRKY domain
SuperFamilySSF1182901.7E-2891157IPR003657WRKY domain
PROSITE profilePS5081129.37993158IPR003657WRKY domain
SMARTSM007741.1E-3698157IPR003657WRKY domain
PfamPF031063.9E-2599156IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0050832Biological Processdefense response to fungus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 160 aa     Download sequence    Send to blast
MSNINLIPQD SPESDSAEKT NFELSEYLTF DEWFEDDQAS KLFGYVQNPV YRANEVVEPG  60
GTSTHFEGPS NSDNDSGREK KPVKERVAFK TKSDVEILDD GFKWRKYGKK MVKNSPNPRN  120
YYKCSVDGCP VKKRVERDRD DPSYVITTYE GFHTHQSNP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-2488155774Probable WRKY transcription factor 4
2lex_A1e-2488155774Probable WRKY transcription factor 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00531DAPTransfer from AT5G26170Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB5731491e-114AB573149.1 Citrus unshiu genomic DNA, polyembryony locus, cultivar: Miyagawa wase.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006474454.11e-108probable WRKY transcription factor 50 isoform X1
RefseqXP_024033930.11e-108probable WRKY transcription factor 50 isoform X1
SwissprotQ8VWQ51e-49WRK50_ARATH; Probable WRKY transcription factor 50
TrEMBLA0A067GDY41e-115A0A067GDY4_CITSI; Uncharacterized protein
TrEMBLV4UPS51e-115V4UPS5_9ROSI; Uncharacterized protein
STRINGXP_006453040.11e-115(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM61212747
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26170.15e-52WRKY DNA-binding protein 50
Publications ? help Back to Top
  1. Brand LH,Kirchler T,Hummel S,Chaban C,Wanke D
    DPI-ELISA: a fast and versatile method to specify the binding of plant transcription factors to DNA in vitro.
    Plant Methods, 2010. 6: p. 25
    [PMID:21108821]