PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g029650m
Common NameCISIN_1g029650mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family SBP
Protein Properties Length: 191aa    MW: 21171.6 Da    PI: 8.7157
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g029650mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP138.61.8e-4366142278
                        -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                        Cqv++C adls+ak+yhrrhkvCevh+ka+vvl+ g++qrfCqqCsrfhelsefDe+krsCrrrLa+hnerrrk++a
  orange1.1g029650m  66 CQVDKCGADLSDAKQYHRRHKVCEVHAKAQVVLMGGIRQRFCQQCSRFHELSEFDETKRSCRRRLAGHNERRRKNAA 142
                        **************************************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.105.2E-3558127IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.56563140IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.53E-3965143IPR004333Transcription factor, SBP-box
PfamPF031101.1E-3366139IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010321Biological Processregulation of vegetative phase change
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 191 aa     Download sequence    Send to blast
MDAKRKNKMV KVVKKEEATA AFVDSDDDDD DGGEYDLCPQ EEGDDNRNSS SKKNKGSSGG  60
SGLRSCQVDK CGADLSDAKQ YHRRHKVCEV HAKAQVVLMG GIRQRFCQQC SRFHELSEFD  120
ETKRSCRRRL AGHNERRRKN AAESNGEGSS CKGTGTGTQL KDLVCGKLDD KGRIKISIQE  180
NATCKHFQIR *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A6e-4356139184squamosa promoter binding protein-like 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Csi.16910.0fruit
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00634PBMTransfer from PK22320.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006447265.11e-115hypothetical protein CICLE_v10016841mg
RefseqXP_006469892.11e-115PREDICTED: squamosa promoter-binding protein 1-like
SwissprotQ9S7A91e-44SPL4_ARATH; Squamosa promoter-binding-like protein 4
TrEMBLA0A067DGL71e-137A0A067DGL7_CITSI; Uncharacterized protein
STRINGPOPTR_0007s01030.15e-67(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM86828118
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G53160.22e-44squamosa promoter binding protein-like 4