PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g029214m
Common NameCISIN_1g028980mg, LOC102611194
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family YABBY
Protein Properties Length: 198aa    MW: 22047 Da    PI: 8.5043
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g029214mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY208.91.9e-6481705170
              YABBY   5 ssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkeelleelkveeenlksnvekeesastsv 96 
                         ++eq+Cy+ CnfCn +lavsvP +sl+ +vtvrCGhC++l svn+a a q l+ ++  +++       e + +  + +  + +++ +   +
  orange1.1g029214m   8 VAPEQLCYIPCNFCNIVLAVSVPCSSLLDIVTVRCGHCSNLWSVNMAAAFQSLSWQDVHHHQAPSYASPECRIDLGSSS--KCNNKISAMRT 97 
                        689**************************************************99996444444444444444433222..22222222223 PP

              YABBY  97 sseklsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170
                        +++k  ++e+    r  p    PekrqrvPsayn+fikeeiqrika+nPdishreafs+aaknWahfP+ihfgl
  orange1.1g029214m  98 PTNK-ATEERVVNRRESPHSTTPEKRQRVPSAYNQFIKEEIQRIKANNPDISHREAFSTAAKNWAHFPHIHFGL 170
                        3322.33444444455567889**************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046902.1E-689170IPR006780YABBY protein
SuperFamilySSF470956.28E-8110163IPR009071High mobility group box domain
Gene3DG3DSA:1.10.30.101.3E-4117164IPR009071High mobility group box domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:1902183Biological Processregulation of shoot apical meristem development
GO:2000024Biological Processregulation of leaf development
Sequence ? help Back to Top
Protein Sequence    Length: 198 aa     Download sequence    Send to blast
MSSCGIDVAP EQLCYIPCNF CNIVLAVSVP CSSLLDIVTV RCGHCSNLWS VNMAAAFQSL  60
SWQDVHHHQA PSYASPECRI DLGSSSKCNN KISAMRTPTN KATEERVVNR RESPHSTTPE  120
KRQRVPSAYN QFIKEEIQRI KANNPDISHR EAFSTAAKNW AHFPHIHFGL MLEANNQPKL  180
DDASGNRLMS RTALRNK*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Csi.117340.0callus| flower| leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0902161e-69BT090216.1 Soybean clone JCVI-FLGm-3N14 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006450895.11e-147hypothetical protein CICLE_v10009560mg
RefseqXP_006475868.11e-147PREDICTED: axial regulator YABBY 5 isoform X1
SwissprotQ8GW469e-83YAB5_ARATH; Axial regulator YABBY 5
TrEMBLA0A067GNH41e-147A0A067GNH4_CITSI; Uncharacterized protein
TrEMBLV4UIV51e-147V4UIV5_9R
STRINGVIT_11s0016g05590.t011e-110(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G26580.25e-84YABBY family protein