PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g027472m
Common NameCISIN_1g027472mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family LBD
Protein Properties Length: 224aa    MW: 24594.4 Da    PI: 8.4165
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g027472mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260142.91e-44111101100
             DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlka 92 
                        +CaaCk+lrrkC+++Cv+apyfp +qp+kfanvhk+FGasnv+kll++l++++reda++sl+yeAe+r+rdPvyG+vgvi+ lq++l+ql+ 
  orange1.1g027472m  11 PCAACKLLRRKCQPECVFAPYFPPDQPQKFANVHKVFGASNVTKLLNELQPSQREDAVNSLAYEAEMRLRDPVYGCVGVISFLQHRLRQLQM 102
                        7******************************************************************************************* PP

             DUF260  93 elallkee 100
                        +l+ +k+e
  orange1.1g027472m 103 DLSCAKSE 110
                        ***99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.11610111IPR004883Lateral organ boundaries, LOB
PfamPF031957.5E-4411108IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009799Biological Processspecification of symmetry
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0009954Biological Processproximal/distal pattern formation
GO:0048441Biological Processpetal development
GO:0005654Cellular Componentnucleoplasm
Sequence ? help Back to Top
Protein Sequence    Length: 224 aa     Download sequence    Send to blast
MASSSSSSNS PCAACKLLRR KCQPECVFAP YFPPDQPQKF ANVHKVFGAS NVTKLLNELQ  60
PSQREDAVNS LAYEAEMRLR DPVYGCVGVI SFLQHRLRQL QMDLSCAKSE LSKYQNLGHA  120
GLIAAAHHHH HHQNMGMNLI GGAGGGGRDH HFHHHFFPRD HHPNNNHNHN QHHQMIRGFD  180
GAAAANGNNY DATLLAAGIG QFTQFQQPRA AAGDDRRSSI DPS*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00211DAPTransfer from AT1G65620Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006468642.11e-164PREDICTED: LOB domain-containing protein 6
RefseqXP_006468643.11e-164PREDICTED: LOB domain-containing protein 6
SwissprotO044793e-93LBD6_ARATH; LOB domain-containing protein 6
TrEMBLA0A067GBP41e-166A0A067GBP4_CITSI; Uncharacterized protein
STRINGVIT_00s0340g00090.t011e-103(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM126792531
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65620.47e-74LBD family protein