PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g027395m
Common NameCISIN_1g027395mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family M-type_MADS
Protein Properties Length: 225aa    MW: 25903.8 Da    PI: 7.5383
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g027395mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF70.81.2e-221059251
                       ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
             SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                       +i+n+   qvt++kRr gi KKA+ELSvLCd++v +++fs++gkl  yss
  orange1.1g027395m 10 KIDNYPALQVTYTKRRDGIVKKAKELSVLCDTDVGLLMFSPSGKLTKYSS 59
                       699999******************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.3E-29160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006624.824161IPR002100Transcription factor, MADS-box
SuperFamilySSF554555.23E-23271IPR002100Transcription factor, MADS-box
PRINTSPR004047.1E-19323IPR002100Transcription factor, MADS-box
PfamPF003191.0E-191057IPR002100Transcription factor, MADS-box
PRINTSPR004047.1E-192338IPR002100Transcription factor, MADS-box
PRINTSPR004047.1E-193859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 225 aa     Download sequence    Send to blast
MGRRKLLMQK IDNYPALQVT YTKRRDGIVK KAKELSVLCD TDVGLLMFSP SGKLTKYSSS  60
RRIEDIFLRF ICDEKQEPLE NEDHLYRSLV HSKCEGEMLD LIKKKEELEK KLIELCERQF  120
DAEEKMSFYQ PKVEDITTIH EAVDHEKFLN SAIRRVEKLN AKLLQKESAS RIPESIELEA  180
ASFFDGNEVP VPPNSKKKGG IHQCVNITMH EQTHPPVSTQ RINT*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Csi.30250.0flower
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006447462.21e-127agamous-like MADS-box protein AGL66
RefseqXP_006469733.11e-127agamous-like MADS-box protein AGL66
TrEMBLA0A067F8R41e-164A0A067F8R4_CITSI; Uncharacterized protein
STRINGXP_006469733.11e-126(Citrus sinensis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16598611
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22130.16e-24AGAMOUS-like 104