PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g027307m
Common NameCISIN_1g027307mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family LBD
Protein Properties Length: 226aa    MW: 24581.9 Da    PI: 8.8553
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g027307mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260135.71.7e-42421421101
             DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlka 92 
                        +CaaCk+lrr+Ca++C+++pyf  ++p+kfa vhk+FGasnv+k+l+++pe++r da++slvyeA++r+rdPvyG++g i++lqqq+++l+a
  orange1.1g027307m  42 PCAACKLLRRRCAQECPFSPYFSPHEPQKFASVHKVFGASNVSKMLNDVPESQRADAANSLVYEANVRLRDPVYGCMGAISTLQQQVQCLQA 133
                        7******************************************************************************************* PP

             DUF260  93 elallkeel 101
                        el+++++e+
  orange1.1g027307m 134 ELNVVRNEI 142
                        ****99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.0341142IPR004883Lateral organ boundaries, LOB
PfamPF031951.3E-4242139IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    Send to blast
MSRERERFDE IGKKIKREAD ASSHMGRRHM LGPPGTLNTI TPCAACKLLR RRCAQECPFS  60
PYFSPHEPQK FASVHKVFGA SNVSKMLNDV PESQRADAAN SLVYEANVRL RDPVYGCMGA  120
ISTLQQQVQC LQAELNVVRN EIIKYKYREA SNVMPSSHHP HQVALLSSGA VTVAAAPSPS  180
LHTPQPPPPP LPSTPSCSSS MYAQPITSAA DYSTISGNQN VSYFG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006486213.11e-145PREDICTED: LOB domain-containing protein 15
RefseqXP_006435864.11e-145hypothetical protein CICLE_v10032684mg
SwissprotQ8L5T58e-89LBD15_ARATH; LOB domain-containing protein 15
TrEMBLA0A067DN371e-168A0A067DN37_CITSI; Uncharacterized protein
STRINGVIT_13s0067g02380.t011e-114(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19272781
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.15e-88LOB domain-containing protein 15