PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g027215m
Common NameCISIN_1g027215mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family YABBY
Protein Properties Length: 227aa    MW: 25103.8 Da    PI: 8.1652
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g027215mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY230.15.7e-71121872170
              YABBY   2 dvfssseqvCyvqCnfCntila........vsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkee..lleelkveeenlk 83 
                        d+ ssseq+Cyv+C+fC+t+la        vsvP tslfk+vtvrCGhCt+llsvn++      a + hl++ +  +  llee ++     +
  orange1.1g027215m  12 DHLSSSEQLCYVHCTFCDTVLAvpyhfifsVSVPCTSLFKTVTVRCGHCTNLLSVNMRGLLLPAANQLHLGHPFFTPqnLLEEIRNVPA--N 101
                        7899***************9873333333369**********************98888777777777777777655224444444443..3 PP

              YABBY  84 snvekeesastsvsseklsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170
                        + +++  ++ +++s++ +   +++e+p+ p v+rPPekrqrvPsaynrfik+eiqrika+nPdishreafsaaaknWahfP+ihfgl
  orange1.1g027215m 102 MLMINPPNP-ADQSVMPVRVVDHQEIPKSPVVNRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGL 187
                        444443333.44455567889999*************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046901.9E-6616187IPR006780YABBY protein
SuperFamilySSF470956.55E-8131180IPR009071High mobility group box domain
Gene3DG3DSA:1.10.30.102.3E-4136179IPR009071High mobility group box domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009909Biological Processregulation of flower development
GO:0009933Biological Processmeristem structural organization
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0010093Biological Processspecification of floral organ identity
GO:0010154Biological Processfruit development
GO:0010158Biological Processabaxial cell fate specification
GO:0010159Biological Processspecification of organ position
GO:0010450Biological Processinflorescence meristem growth
GO:1902183Biological Processregulation of shoot apical meristem development
GO:2000024Biological Processregulation of leaf development
Sequence ? help Back to Top
Protein Sequence    Length: 227 aa     Download sequence    Send to blast
MSSSTPAALS PDHLSSSEQL CYVHCTFCDT VLAVPYHFIF SVSVPCTSLF KTVTVRCGHC  60
TNLLSVNMRG LLLPAANQLH LGHPFFTPQN LLEEIRNVPA NMLMINPPNP ADQSVMPVRV  120
VDHQEIPKSP VVNRPPEKRQ RVPSAYNRFI KDEIQRIKAG NPDISHREAF SAAAKNWAHF  180
PHIHFGLMPS DQPVKKTSVR QQQEGEDAMI KDGFFAPAAN VGVTPY*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Csi.5460.0flower| fruit
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00620PBMTransfer from AT2G45190Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB9382121e-57AB938212.1 Sarracenia purpurea FIL mRNA for filamentous flower, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006445302.11e-160hypothetical protein CICLE_v10022170mg
RefseqXP_006490878.11e-160PREDICTED: axial regulator YABBY 1
SwissprotO221529e-96YAB1_ARATH; Axial regulator YABBY 1
TrEMBLA0A067HD731e-169A0A067HD73_CITSI; Uncharacterized protein
STRINGVIT_15s0048g00550.t011e-118(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM22172877
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45190.15e-97YABBY family protein