PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g026950m
Common NameCISIN_1g026950mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family WRKY
Protein Properties Length: 231aa    MW: 25883.2 Da    PI: 9.2281
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g026950mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY102.42.5e-32152210159
                        ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
               WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                        ldDgy+WrKYGqK+vk++++prsYYrCt+ +C+vkk+ver aedp++v++tYeg+H h+
  orange1.1g026950m 152 LDDGYKWRKYGQKVVKNTQHPRSYYRCTQDNCRVKKRVERLAEDPRMVITTYEGRHVHS 210
                        59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.3E-33137210IPR003657WRKY domain
SuperFamilySSF1182901.27E-28144211IPR003657WRKY domain
PROSITE profilePS5081129.356147212IPR003657WRKY domain
SMARTSM007749.8E-37152211IPR003657WRKY domain
PfamPF031063.5E-25153209IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1901141Biological Processregulation of lignin biosynthetic process
GO:1904369Biological Processpositive regulation of sclerenchyma cell differentiation
GO:0001046Molecular Functioncore promoter sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    Send to blast
MSSTSQAMLN QSLFEEQEMP TQMGFFPFAS NLNFAPLGNQ SLKAFPSSLA AADVPSTINL  60
TETLLSSAAA AGNLKQTTCD NLGGGAQLLS LQRSSANLWA WGGDVNECLS NKRTVDDHHL  120
GVAAMKMKKI KSRRKVREPR FCFKTMSDID VLDDGYKWRK YGQKVVKNTQ HPRSYYRCTQ  180
DNCRVKKRVE RLAEDPRMVI TTYEGRHVHS PSHDQEDSSQ ASSHLNNFFW *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A4e-27143209874Probable WRKY transcription factor 4
2lex_A4e-27143209874Probable WRKY transcription factor 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006464513.11e-174probable WRKY transcription factor 13 isoform X1
SwissprotQ9SVB71e-63WRK13_ARATH; Probable WRKY transcription factor 13
TrEMBLA0A067DNU11e-174A0A067DNU1_CITSI; Uncharacterized protein
STRINGXP_006464513.11e-174(Citrus sinensis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM61062746
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G39410.16e-64WRKY DNA-binding protein 13