PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g026227m
Common NameCISIN_1g025187mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family GeBP
Protein Properties Length: 242aa    MW: 28273.2 Da    PI: 8.9065
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g026227mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF57381.11.7e-2547141297
             DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelsk 93 
                        +f+r+w+e Dei +LqGl+d  a+ g     d+  fye +++ +s  +sk ql+eK+rrL+kKf+  ++++++g ++s  + hd++ fels+
  orange1.1g026227m  47 KFHRIWTEPDEIRFLQGLLDS-ASLGLTFPRDLPIFYERFSNAMSQPYSKYQLSEKLRRLRKKFRVTSSRISRGLNISHLNFHDRNLFELSM 137
                        699*****************8.889999999************************************************************* PP

             DUF573  94 kiWg 97 
                        k+W 
  orange1.1g026227m 138 KLWS 141
                        ***7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045041.4E-2648141IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 242 aa     Download sequence    Send to blast
MDSLKPSSAS KSKLPIKRKS EQSHNQDQSI TTVDFTDPTN INPPPFKFHR IWTEPDEIRF  60
LQGLLDSASL GLTFPRDLPI FYERFSNAMS QPYSKYQLSE KLRRLRKKFR VTSSRISRGL  120
NISHLNFHDR NLFELSMKLW SPECLPTSPF GKISVCGGNV DVDFSSCGKK EKETIEEVAV  180
ARSVLDVFDE CLKEVRMIVA NQPKEEREKD FERLWREQRF AEFDVLTRRL RLVLDDYFNW  240
Q*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006482084.11e-169probable transcription factor At4g00390 isoform X1
TrEMBLA0A067EI761e-177A0A067EI76_CITSI; Uncharacterized protein
STRINGXP_006482084.11e-168(Citrus sinensis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04930.22e-17DNA-binding storekeeper protein-related transcriptional regulator