PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g026216m
Common NameCISIN_1g026216mg, LOC102623361
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family WRKY
Protein Properties Length: 242aa    MW: 27084.6 Da    PI: 7.5177
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g026216mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY102.42.6e-32167225159
                        ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
               WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                        ldDgy+WrKYGqK vk+s +prsYYrCt+++C+vkk+ver +ed ++v++tYeg+Hnh+
  orange1.1g026216m 167 LDDGYKWRKYGQKIVKNSLHPRSYYRCTHNNCRVKKRVERLSEDCRMVITTYEGRHNHS 225
                        59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.2E-33152225IPR003657WRKY domain
SuperFamilySSF1182901.7E-28159225IPR003657WRKY domain
PROSITE profilePS5081129.493162224IPR003657WRKY domain
SMARTSM007741.9E-37167226IPR003657WRKY domain
PfamPF031062.8E-25168224IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 242 aa     Download sequence    Send to blast
MEGEKSSAGA GVGIPNYEVQ ASFTTAEAEA AAAAAAAQGM GSFVHDFDEN HEHQVLSFMG  60
APPSNSHSHY SSPISLHPLI INSRHSTENS ALGFTHTSNH DHHHQVGPLN PRAVNNENCT  120
SNHASDEGHN SWWRSSSSSE KINKVKARRK LREPRFCFQT RSDVDVLDDG YKWRKYGQKI  180
VKNSLHPRSY YRCTHNNCRV KKRVERLSED CRMVITTYEG RHNHSPCDDS NSSDHECFAH  240
F*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-26158224874Probable WRKY transcription factor 4
2lex_A3e-26158224874Probable WRKY transcription factor 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00618PBMTransfer from AT2G44745Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006445445.10.0probable WRKY transcription factor 12
RefseqXP_006464409.10.0probable WRKY transcription factor 12
SwissprotQ93WY47e-71WRK12_ARATH; Probable WRKY transcription factor 12
TrEMBLA0A067HCG90.0A0A067HCG9_CITSI; Uncharacterized protein
TrEMBLA0A2H5PZU20.0A0A2H5PZU2_CITUN; Uncharacterized protein
TrEMBLV4U3R20.0V4U3R2_9ROSI; Uncharacterized protein
STRINGXP_006464409.10.0(Citrus sinensis)
STRINGXP_006445445.10.0(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM60452546
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G44745.12e-65WRKY family protein
Publications ? help Back to Top
  1. Yu Y, et al.
    MlWRKY12, a novel Miscanthus transcription factor, participates in pith secondary cell wall formation and promotes flowering.
    Plant Sci., 2013. 212: p. 1-9
    [PMID:24094048]
  2. Yang L, et al.
    PtrWRKY19, a novel WRKY transcription factor, contributes to the regulation of pith secondary wall formation in Populus trichocarpa.
    Sci Rep, 2016. 6: p. 18643
    [PMID:26819184]
  3. Li W,Wang H,Yu D
    Arabidopsis WRKY Transcription Factors WRKY12 and WRKY13 Oppositely Regulate Flowering under Short-Day Conditions.
    Mol Plant, 2016. 9(11): p. 1492-1503
    [PMID:27592586]
  4. Han Y, et al.
    WRKY12 represses GSH1 expression to negatively regulate cadmium tolerance in Arabidopsis.
    Plant Mol. Biol., 2019. 99(1-2): p. 149-159
    [PMID:30617455]