PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g025998m
Common NameCISIN_1g025998mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family Dof
Protein Properties Length: 246aa    MW: 27535.3 Da    PI: 4.6557
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g025998mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof119.99.3e-381169462
             zf-Dof  4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                       +a +cprC s ntkfCyynnyslsqPryfCk+CrryWtkGG+lrnvPvGgg+rkn +++
  orange1.1g025998m 11 TAPSCPRCASPNTKFCYYNNYSLSQPRYFCKGCRRYWTKGGSLRNVPVGGGCRKNGRAK 69
                       5678**************************************************98765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074787.0E-28167IPR003851Zinc finger, Dof-type
PfamPF027011.5E-311366IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.2951367IPR003851Zinc finger, Dof-type
PROSITE patternPS0136101551IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MEKKWKPDVE TAPSCPRCAS PNTKFCYYNN YSLSQPRYFC KGCRRYWTKG GSLRNVPVGG  60
GCRKNGRAKS SRRKSPFNND RPKASCSSDH TDDAVSTPNG GSDIDLAVVF ANSSTPDNVV  120
QNDDFNVHNV MGNGDLNILG EFPQVFGQLQ EEEDRRVQDF LEDDMVNAHG LQALLGDEIV  180
DHQVALWSDQ AETETLPNFT WQRAMFQLQD FDSFPADDQL KASANLISDN WTSFDLPGFE  240
LYSRP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006434423.11e-179hypothetical protein CICLE_v10002179mg
SwissprotP683497e-45DOF12_ARATH; Dof zinc finger protein DOF1.2
TrEMBLA0A067H7W40.0A0A067H7W4_CITSI; Uncharacterized protein
STRINGPOPTR_0005s21130.17e-80(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM64622643
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21340.14e-46Dof family protein