PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g024884m
Common NameCISIN_1g024884mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family M-type_MADS
Protein Properties Length: 262aa    MW: 29056.1 Da    PI: 9.3349
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g024884mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF542.1e-171050242
                       ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
             SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                       +i+ +  r  tf kR+n +lKKA+E  +LCd+ev++ii+++
  orange1.1g024884m 10 PIKHEKARLATFKKRKNSLLKKAYEFATLCDVEVCIIIYGP 50
                       6889999********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006615.755149IPR002100Transcription factor, MADS-box
SMARTSM004323.9E-10160IPR002100Transcription factor, MADS-box
PRINTSPR004042.5E-8323IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.62E-16678IPR002100Transcription factor, MADS-box
CDDcd002661.65E-16653No hitNo description
PfamPF003193.7E-181151IPR002100Transcription factor, MADS-box
PRINTSPR004042.5E-82338IPR002100Transcription factor, MADS-box
PRINTSPR004042.5E-83859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 262 aa     Download sequence    Send to blast
MACEALKLEP IKHEKARLAT FKKRKNSLLK KAYEFATLCD VEVCIIIYGP GVKGQSLKPE  60
IWTLKEGQLT SIIRKYKKKI SAVDHGQQRT LSLAKFDESK TRQVDDAATM ARKKICVGDF  120
TTWDQGMDSF SEDQLKMILS TMDDKLKAAD RKLNMIKGDQ NLKNKAASRK LDHDHSNDAK  180
SLVNSQPGYE VSQKLPSDSS FMEIQCGGES GGTIPFTPLQ RQINWNSSLT MSPASSGVYD  240
GNAAQAKKSN DILKDQSSQE E*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Csi.16460.0fruit| seed
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006430718.10.0agamous-like MADS-box protein AGL82
RefseqXP_024037550.10.0agamous-like MADS-box protein AGL82
TrEMBLA0A067FIF50.0A0A067FIF5_CITSI; Uncharacterized protein
STRINGXP_006430718.10.0(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2105535
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58890.16e-23AGAMOUS-like 82