PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g024274m
Common NameCISIN_1g024274mg, LOC102629358
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family Trihelix
Protein Properties Length: 271aa    MW: 32192.9 Da    PI: 6.357
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g024274mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix73.43.9e-231596186
           trihelix  1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86
                       +W ++e+++Li +r e+e++l   k++k+ We vs k+rerg++r+p qCk+kw+nl +ryk  ++++ +    s ++cp+f++l+
  orange1.1g024274m 15 QWGNEETRDLIVIRGETERDLVGIKRNKTIWEIVSVKLRERGYSRTPDQCKCKWKNLVNRYKGKETSDPD----SGRQCPFFNELH 96
                       7**************************************************************9999997....4678******98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF138373.6E-221497No hitNo description
CDDcd122033.96E-181579No hitNo description
PROSITE profilePS500907.0731672IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
MMTSSSSSAH AQAVQWGNEE TRDLIVIRGE TERDLVGIKR NKTIWEIVSV KLRERGYSRT  60
PDQCKCKWKN LVNRYKGKET SDPDSGRQCP FFNELHAVFT ERAKNMQRLL AESEAGSMQA  120
KKRFKRLNAD ELSDEEDDDE EQSEEEEEEE ERPARGNSRK RKIERNVSDK SPRATSGTAG  180
IHEMLKAFFD QQQRMEVEWR QMMERRAQER QLFEEEWRQR MEKLERERLL VEQAWREKEE  240
QRRIREESRA ERRDALLTTL LTKLINQNNP *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006432827.10.0trihelix transcription factor GT-3b
RefseqXP_006471559.10.0trihelix transcription factor GT-3b
TrEMBLA0A067E9D10.0A0A067E9D1_CITSI; Uncharacterized protein
TrEMBLV4SZ120.0V4SZ12_9ROSI; Uncharacterized protein
STRINGXP_006471559.10.0(Citrus sinensis)
STRINGXP_006432827.10.0(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17512910
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38250.16e-36Trihelix family protein