PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g023677m
Common NameCISIN_1g023677mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family MYB_related
Protein Properties Length: 280aa    MW: 31855.8 Da    PI: 9.1398
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g023677mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.21.7e-1786131148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        rg++T++E+ l +++++++G++ W++Iar+++ gRt++++k++w++++
  orange1.1g023677m  86 RGKMTPQEERLVLELHAKWGNR-WSRIARKLP-GRTDNEIKNYWRTHM 131
                        89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500904.4374180IPR017877Myb-like domain
SuperFamilySSF466892.97E-2266136IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.8E-106692IPR009057Homeodomain-like
PROSITE profilePS5129427.50881135IPR017930Myb domain
SMARTSM007174.4E-1785133IPR001005SANT/Myb domain
PfamPF002496.2E-1686130IPR001005SANT/Myb domain
CDDcd001672.77E-1288131No hitNo description
Gene3DG3DSA:1.10.10.601.2E-2093132IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 280 aa     Download sequence    Send to blast
MDRAGGHTAG ELCAAVWRSA LGFYCESFRF EGGGRQYNRG RLFRRYTNFR RSNSFNYMKY  60
FVVGLNRTGK SCRLRWVNYL HPGLKRGKMT PQEERLVLEL HAKWGNRWSR IARKLPGRTD  120
NEIKNYWRTH MRKKAQERKR AVSSPSSSSS NYSSPSSTVT TVDSMPCPPP QGKASFYDTG  180
GNDETRVAAA LVEEYETSCY SMDDIWKDIE LSEEKIMKQD GNGNVNFACP SPMAAPACWG  240
YSSWDSIWKM DEADEESKMM INLPTDDQFI SSWAATLTG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A7e-186713537105MYB PROTO-ONCOGENE PROTEIN
1h88_C2e-176713591159MYB PROTO-ONCOGENE PROTEIN
1h89_C2e-176713591159MYB PROTO-ONCOGENE PROTEIN
1h8a_C1e-176713560128MYB TRANSFORMING PROTEIN
1mse_C7e-186713537105C-Myb DNA-Binding Domain
1msf_C7e-186713537105C-Myb DNA-Binding Domain
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Mainly expressed in leaves and seedlings, and to a lower extent, in roots, stems and inflorescences. Isoform MYB48-1, isoform MYB48-3 and isoform MYB48-4 are present in all of these organs, but isoform MYB48-2 is confined to leaves. {ECO:0000269|PubMed:16531467}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. {ECO:0000305}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By salicylic acid (SA). {ECO:0000269|PubMed:16463103}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006488255.10.0transcription factor MYB59 isoform X1
SwissprotQ9LX828e-62MYB48_ARATH; Transcription factor MYB48
TrEMBLA0A067FZZ20.0A0A067FZZ2_CITSI; Uncharacterized protein
STRINGXP_006488255.10.0(Citrus sinensis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM25022774
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46130.42e-66myb domain protein 48
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Nishida S,Kakei Y,Shimada Y,Fujiwara T
    Genome-wide analysis of specific alterations in transcript structure and accumulation caused by nutrient deficiencies in Arabidopsis thaliana.
    Plant J., 2017. 91(4): p. 741-753
    [PMID:28586097]
  4. Imran QM, et al.
    Transcriptome profile of NO-induced Arabidopsis transcription factor genes suggests their putative regulatory role in multiple biological processes.
    Sci Rep, 2018. 8(1): p. 771
    [PMID:29335449]