PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g023047m
Common NameCISIN_1g023047mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family Dof
Protein Properties Length: 289aa    MW: 31781.4 Da    PI: 8.3654
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g023047mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof126.48.8e-4040101263
             zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63 
                        ke+al+cprC+stntkfCyynnysl+qPryfCk+CrryWt+GG+lrn+PvGgg+rknk+sss
  orange1.1g023047m  40 KEQALNCPRCNSTNTKFCYYNNYSLTQPRYFCKTCRRYWTEGGSLRNIPVGGGSRKNKRSSS 101
                        7899******************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-282692IPR003851Zinc finger, Dof-type
PfamPF027011.5E-334298IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.1344498IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104682IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MDTAQWPQEI VVKPIEEIVT NTCPKPASAA ALERKARPQK EQALNCPRCN STNTKFCYYN  60
NYSLTQPRYF CKTCRRYWTE GGSLRNIPVG GGSRKNKRSS SSSKKLPDPA TPPSHHPHQN  120
PKIHDHGEDL NLSFPAATTQ GYRSFSELVQ LPNIDNKSQI PISSSTTTTT TTTSSQQLSA  180
LELLTGISSR GLNSFMPMPV PDPNAIYAPG FPMQDFKPTL NFSLDGLGSG YGSLHHQSVQ  240
ENNGRLLFPF EDLKQVSSTS DHMEQNREHG DSSGYWTGML GGGSWWGA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006476323.10.0PREDICTED: dof zinc finger protein DOF4.6 isoform X1
SwissprotQ8LAP81e-71DOF46_ARATH; Dof zinc finger protein DOF4.6
TrEMBLA0A067GDE50.0A0A067GDE5_CITSI; Uncharacterized protein
STRINGPOPTR_0003s14450.11e-143(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34332761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24060.17e-63Dof family protein