PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g022872m
Common NameCISIN_1g021641mg, LOC102631213
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family Dof
Protein Properties Length: 292aa    MW: 31822 Da    PI: 8.7837
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g022872mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.61.6e-392685261
             zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                       ++++l+cprC+stntkfCyynnysl+qPryfCk+CrryWt+GG+lrnvPvGgg+rknk+s
  orange1.1g022872m 26 PQEQLNCPRCNSTNTKFCYYNNYSLTQPRYFCKTCRRYWTEGGSLRNVPVGGGSRKNKRS 85
                       6899******************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074787.0E-282584IPR003851Zinc finger, Dof-type
PfamPF027012.2E-332884IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.1993084IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103268IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009639Biological Processresponse to red or far red light
GO:0009845Biological Processseed germination
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MEEVVSNTCN SSSSSRPPML ERKARPQEQL NCPRCNSTNT KFCYYNNYSL TQPRYFCKTC  60
RRYWTEGGSL RNVPVGGGSR KNKRSISSSA AAASSSNNNN NNNNNYNKLI IPDLNPPSLS  120
HFSSHENPKI LKGGQDLNLG FQVMHNNAND MSQYADHPAV ASKAETNTTS NDNINNNMSP  180
VSALDLLRTG IASRAGLDHF IPTPMPDSNT LFSSGFPLQD IKPAATLSFS IDQANRFGIQ  240
DNIGNGSRLF FPFGELKQLS SASTTEVDHH SNKGTSTSTG YWNGMFGGGS W*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Csi.91790.0stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006444805.10.0hypothetical protein CICLE_v10020725mg
RefseqXP_006491311.10.0PREDICTED: dof zinc finger protein DOF2.5 isoform X1
RefseqXP_006491312.10.0PREDICTED: dof zinc finger protein DOF2.5 isoform X2
SwissprotQ433853e-61DOF37_ARATH; Dof zinc finger protein DOF3.7
SwissprotQ9ZPY03e-61DOF25_ARATH; Dof zinc finger protein DOF2.5
TrEMBLA0A067H3T50.0A0A067H3T5_CITSI; Uncharacterized protein
TrEMBLA0A067H3D80.0A0A067H3D8_CITSI; Uncharacterized protein
TrEMBLV4U1W40.0V4U1W4_9R
STRINGPOPTR_0002s17490.11e-102(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61850.46e-65Dof family protein