PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g022767m
Common NameCISIN_1g022763mg, LOC102622170
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family Trihelix
Protein Properties Length: 293aa    MW: 33272.2 Da    PI: 5.683
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g022767mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix36.31.4e-111987270
           trihelix  2 WtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekk 70
                       W+ +e l L++    +e +  ++ +  ++W+ +s+ + +  + r+++qC+ kw++l  +ykk+  +++ 
  orange1.1g022767m 19 WSSKEALILVNEIAAVEADCLKALSSYQKWKIISETCTALDVPRTANQCRRKWDSLLDEYKKMIVRSRT 87
                       **************************************************************8766655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF138372.3E-91885No hitNo description
Gene3DG3DSA:1.10.10.606.0E-51876IPR009057Homeodomain-like
PROSITE profilePS500907.1781975IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009506Cellular Componentplasmodesma
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MEGGSSGTRR TRSQVGPDWS SKEALILVNE IAAVEADCLK ALSSYQKWKI ISETCTALDV  60
PRTANQCRRK WDSLLDEYKK MIVRSRTFPN SQTQTHTDCF PPNFDSELFK AIHDFVMSKD  120
NRSDDTDPDS DTDPEADFSE AISQAQLGSK RQRRQSMRVK HCAEQKPLKS CLHENHQKSG  180
CTEEKLCNSH VEEEPRIRLV EKKCQNSRIK EKKSLKSCVE ENEQMMVAKL QENAELIHAI  240
VAESADYSDA DLNNVQDLES EFVRRQGDKL IACLGEIVNT LNQFTDHVQE CK*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Csi.28940.0callus| fruit
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006483638.10.0uncharacterized protein LOC102622170
RefseqXP_006483639.10.0uncharacterized protein LOC102622170
RefseqXP_024957123.10.0uncharacterized protein LOC102622170
TrEMBLA0A067FII20.0A0A067FII2_CITSI; Uncharacterized protein
STRINGXP_006483638.10.0(Citrus sinensis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G31270.18e-58sequence-specific DNA binding transcription factors