PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g022743m
Common NameCISIN_1g022743mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family Trihelix
Protein Properties Length: 293aa    MW: 34924.2 Da    PI: 8.8316
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g022743mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix78.87.8e-2547129186
           trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                        +W+ qe+++ + +r e+++++ ++k++k lWe +s +mre+g++rs++qCk+kw+nl +ryk ++++e +     ++++p++++l+
  orange1.1g022743m  47 QWSVQETKEFLVIRAELDRSFMETKRNKLLWEVISTRMREKGYNRSAEQCKCKWKNLVTRYKGCETTEPEA---MRQQFPFYNELQ 129
                        7********************************************************************95...56689*****98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.001144106IPR001005SANT/Myb domain
CDDcd122031.05E-2246111No hitNo description
PfamPF138374.3E-2047131No hitNo description
PROSITE profilePS500907.3448104IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0042802Molecular Functionidentical protein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MEGHHQHHQH HHHHHQQQQI HQQQQQQHLQ HPPHISVNVD TSDRFPQWSV QETKEFLVIR  60
AELDRSFMET KRNKLLWEVI STRMREKGYN RSAEQCKCKW KNLVTRYKGC ETTEPEAMRQ  120
QFPFYNELQA IFASRMQRML WAETEGGSKK KAAAAVQLSS EEEDFNEESE GEKGNVMRKK  180
KKSKSSTGGA GASGSGSASS SHNFKEILEE FMKQQMQMEM QWREAFEARE NERRIKEMEW  240
RQTMEALENE RIMMDRRLRE REEQRRMREE ARAEKRDALI TALLNKLRRE DM*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Csi.60660.0callus
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Predominantly expressed in roots and flower buds. {ECO:0000269|PubMed:15044016}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that binds specifically to the core DNA sequence 5'-GTTAC-3'. {ECO:0000269|PubMed:15044016}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00481DAPTransfer from AT5G01380Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006481050.10.0trihelix transcription factor GT-3b
SwissprotQ9SDW07e-73TGT3A_ARATH; Trihelix transcription factor GT-3a
TrEMBLA0A067F0F00.0A0A067F0F0_CITSI; Uncharacterized protein
STRINGXP_006481050.10.0(Citrus sinensis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM22152870
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G01380.11e-53Trihelix family protein