PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g022562m
Common NameCISIN_1g022562mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family MYB_related
Protein Properties Length: 296aa    MW: 32150.8 Da    PI: 8.2477
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g022562mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.92.7e-1488132347
                        SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        +WT+eE++l++ + ++ G+g+W+ I+r + k+Rt+ q+ s+ qky
  orange1.1g022562m  88 PWTEEEHKLFLLGLQKVGKGDWRGISRNFVKTRTPTQVASHAQKY 132
                        8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.99781137IPR017930Myb domain
SuperFamilySSF466894.56E-1783138IPR009057Homeodomain-like
TIGRFAMsTIGR015575.1E-1784135IPR006447Myb domain, plants
SMARTSM007171.8E-1085135IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.8E-1187132IPR009057Homeodomain-like
CDDcd001671.60E-988133No hitNo description
PfamPF002491.7E-1188132IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MSGTGDSSAV NGGGCEIMLF GVRVVVDSMR KSVSLNNLSQ YEQPQDNSSN CNNNNNKDDV  60
AAAGYASADD GVHNNSSRAS RERKRGVPWT EEEHKLFLLG LQKVGKGDWR GISRNFVKTR  120
TPTQVASHAQ KYFLRRSNLN RRRRRSSLFD ITTDSVAATP MEEELVDHQD HNPSQSYPLL  180
PPTPAETSNK SGGFSMMPAL PVVLPVPIEN PMENLTLGQN SQRTAGEATR LIRPVPVPVL  240
PAAQPSSTVS DLNLNLNLAV DPPPLSQRES SSRHSAFQVM QTFNNGDSNS IISVA*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Csi.69290.0flower| fruit| root| stem
Functional Description ? help Back to Top
Source Description
UniProtBinds selectively to the DNA sequence 5'-[GA]GATAA-3' and may act as a transcription factor involved in the regulation of drought-responsive genes. Enhances stomatal closure in response to abscisic acid (ABA). Confers drought and salt tolerance. {ECO:0000269|PubMed:21030505}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00631PBMTransfer from PK23829.1Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by drought, high salinity, and ABA. {ECO:0000269|PubMed:21030505}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006476696.10.0transcription factor MYB1R1-like
SwissprotQ2V9B02e-77MY1R1_SOLTU; Transcription factor MYB1R1
TrEMBLA0A067G2Y70.0A0A067G2Y7_CITSI; Uncharacterized protein
STRINGXP_006476696.10.0(Citrus sinensis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM24612669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19000.24e-59MYB_related family protein
Publications ? help Back to Top
  1. Shin D, et al.
    Expression of StMYB1R-1, a novel potato single MYB-like domain transcription factor, increases drought tolerance.
    Plant Physiol., 2011. 155(1): p. 421-32
    [PMID:21030505]