PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g021875m
Common NameCISIN_1g021851mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family MYB_related
Protein Properties Length: 307aa    MW: 34150.4 Da    PI: 8.5732
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g021875mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding569.4e-182670147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                       r +WT+eE+++++da k++G g W+ I +++g ++t+ q++s+ qk+
  orange1.1g021875m 26 REKWTEEEHQRFLDALKMYGRG-WRQIEEHVG-TKTAVQIRSHAQKF 70
                       789*******************.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.2E-162074IPR009057Homeodomain-like
PROSITE profilePS5129421.4032175IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.7E-92374IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-162473IPR006447Myb domain, plants
SMARTSM007171.0E-122573IPR001005SANT/Myb domain
PfamPF002494.7E-152669IPR001005SANT/Myb domain
CDDcd001675.52E-112871No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MSNSLYSFEN DSLPKVRKPY TITKQREKWT EEEHQRFLDA LKMYGRGWRQ IEEHVGTKTA  60
VQIRSHAQKF FSKVVRESNG SSESSIMPIE IPPPRPKRKP VHPYPRKSVD SLKATSVSNQ  120
QENFTSSNAL VSDKDRQSPT SVVSAFNSDT LGCAASDQQN GCSSPTSCTT EMHSVNLLPI  180
EKENEYVTSI SFPKEEKIST LPAHLSASSN VEELASVSKD SVYPKGDAAA APSCTSIKLF  240
GRTVLVSDSW KPYSLGADSY KSPISKSSQE NLDVDKKILS SQPHQSIWIH IYYLGWFLAI  300
VIHPHI*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00146DAPTransfer from AT1G18330Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006441350.10.0protein REVEILLE 7 isoform X1
TrEMBLA0A067DYI80.0A0A067DYI8_CITSI; Uncharacterized protein
STRINGXP_006441350.10.0(Citrus clementina)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18330.14e-47MYB_related family protein