PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g021142m
Common NameCISIN_1g021142mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family WRKY
Protein Properties Length: 318aa    MW: 35159 Da    PI: 7.3422
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g021142mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY106.71.1e-33173230259
                        --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
               WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                        +Dgy+WrKYGqK vk+s+fprsYYrCt+++C vkk+vers edp++v++tYeg+H h+
  orange1.1g021142m 173 EDGYRWRKYGQKAVKNSPFPRSYYRCTTQKCGVKKRVERSYEDPSIVITTYEGQHSHP 230
                        8********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.803.7E-35157232IPR003657WRKY domain
SuperFamilySSF1182907.85E-30164232IPR003657WRKY domain
PROSITE profilePS5081131.709167232IPR003657WRKY domain
SMARTSM007741.7E-39172231IPR003657WRKY domain
PfamPF031069.4E-27173230IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MSNESRDIYY RALFQPNVNI EAAARPGVSV AASSSSPDYV SPQEFDPSQM NFTDCFHGLM  60
DYNSLEKAFT GMSPSSSEVF SSVEGNQKQV KDLLIPNSSI SSSSAEAGGE EDSHSGKSTQ  120
KDDQALQSPK DHGHGGESSK KMSREKKNNK KGEKKQKEPR VAFMTKSEVD HLEDGYRWRK  180
YGQKAVKNSP FPRSYYRCTT QKCGVKKRVE RSYEDPSIVI TTYEGQHSHP LPTTLRGNAA  240
GIFQSSSMLT PTPMNVSSFP PDQWLGYSNM MPAMTHNQTA APGPNAFVTH PLDDHQLPDN  300
FGLLQDIAPS VFFKREP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-29162232777Probable WRKY transcription factor 4
2lex_A2e-29162232777Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006467520.10.0probable WRKY transcription factor 71
TrEMBLA0A067GHF70.0A0A067GHF7_CITSI; Uncharacterized protein
STRINGXP_006467520.10.0(Citrus sinensis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM15242693
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18170.11e-52WRKY DNA-binding protein 28