PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g020713m
Common NameCISIN_1g020713mg, LOC102612245
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family WRKY
Protein Properties Length: 323aa    MW: 35539.8 Da    PI: 8.6005
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g020713mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY1092.3e-34169226259
                        --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
               WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                        +Dgy+WrKYGqK vk+s+fprsYYrCtsa+C+vkk+vers +dp++v++tYeg+Hnh+
  orange1.1g020713m 169 EDGYRWRKYGQKAVKDSPFPRSYYRCTSASCNVKKRVERSYTDPSIVVTTYEGQHNHP 226
                        8********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0381303.7E-1111322IPR017396PWRKY transcription factor, group IIc
Gene3DG3DSA:2.20.25.807.1E-35153228IPR003657WRKY domain
SuperFamilySSF1182902.09E-29160228IPR003657WRKY domain
PROSITE profilePS5081132.753163228IPR003657WRKY domain
SMARTSM007741.9E-39168227IPR003657WRKY domain
PfamPF031061.7E-26169226IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009624Biological Processresponse to nematode
GO:0009733Biological Processresponse to auxin
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MERKEVTKTK NNNNMGSSPF ADHLSTGSQL RGVFDLYEGE KGSLGFMELL GVQDFGSSSP  60
PSSSLFDMVQ FQAQNQVPSK GASASSTVNV TKIECSELLN QPATPNSSSI SSASSEALND  120
EQVKVEEHVH DEQNQQKTKK QLKPKKTNQK RQREPRFAFM TKSEVDHLED GYRWRKYGQK  180
AVKDSPFPRS YYRCTSASCN VKKRVERSYT DPSIVVTTYE GQHNHPSPLL PRPTLGGVPH  240
AGNGVVGSSF GMPMPAAFSQ QQLPSLVNSL LPMNFGSSFI NGPTTASFLH ERRFCTPAAG  300
TDLLKDHGLL QDIVPSHMLR EE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A7e-29158228777Probable WRKY transcription factor 4
2lex_A7e-29158228777Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Csi.55820.0flower| fruit| seed
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00069PBMTransfer from AT2G47260Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006492359.10.0probable WRKY transcription factor 23
SwissprotO229004e-72WRK23_ARATH; WRKY transcription factor 23
TrEMBLA0A067HG940.0A0A067HG94_CITSI; WRKY transcription factor
STRINGXP_006492359.10.0(Citrus sinensis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM61522647
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47260.12e-62WRKY DNA-binding protein 23
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Guo D,Qin G
    EXB1/WRKY71 transcription factor regulates both shoot branching and responses to abiotic stresses.
    Plant Signal Behav, 2016. 11(3): p. e1150404
    [PMID:26914912]
  4. PrĂ¡t T, et al.
    WRKY23 is a component of the transcriptional network mediating auxin feedback on PIN polarity.
    PLoS Genet., 2018. 14(1): p. e1007177
    [PMID:29377885]