PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g020026m
Common NameCISIN_1g020026mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family bZIP
Protein Properties Length: 333aa    MW: 37031.2 Da    PI: 5.4257
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g020026mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_127.56.8e-09134186860
                        HCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
             bZIP_1   8 rrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklk 60 
                         r   NR +A rs +RK  +i eLe+kv++L++e ++L  +l   +     l 
  orange1.1g020026m 134 SRILANRQSAARSKERKARYISELERKVQTLQTEATTLSAQLTLFQRDTTDLS 186
                        46678**********************************99887766666555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.0E-14126191IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.818129192IPR004827Basic-leucine zipper domain
CDDcd147038.36E-23131181No hitNo description
SuperFamilySSF579594.5E-10132183No hitNo description
Gene3DG3DSA:1.20.5.1704.1E-10132185No hitNo description
PfamPF001702.5E-7134188IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MESQDPPNPN PNPPTRGPYH RRSQSEVQYR IPDDMDLVSD PISDPLFDGP GGSEDDLFCS  60
YMDMDKIGSK PTGDDPKHEN ANVSVGARPR HRYSNSIDGT TSSSSVLESI EAKKAMDPDK  120
LAELWTVDPK RAKSRILANR QSAARSKERK ARYISELERK VQTLQTEATT LSAQLTLFQR  180
DTTDLSTENT ELKLRLQAME QQAQLRDALN EALKKEVERL KVATGEMMTP TDTYNLGMQP  240
IPYNQSLFYP HHPQTGPGDT QIVQLPEFHP FQPNMSTPHQ PMLATANSHA FSEMLQQDPL  300
GRLQGLDING RNSHLVKSEG PSISASESSS TF*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Csi.18130.0fruit
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous. Strongly expressed in mature pollen. {ECO:0000269|PubMed:27896439}.
Functional Description ? help Back to Top
Source Description
UniProtTranscrition factor that may participate with bZIP34 in the gametophytic control of pollen development. {ECO:0000269|PubMed:27896439}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00303DAPTransfer from AT2G40620Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006435914.10.0bZIP transcription factor 18
RefseqXP_006486172.10.0bZIP transcription factor 18
SwissprotO228731e-116BZP18_ARATH; bZIP transcription factor 18
TrEMBLA0A067DMY90.0A0A067DMY9_CITSI; Uncharacterized protein
STRINGXP_006486172.10.0(Citrus sinensis)
STRINGXP_006435914.10.0(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40422757
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40620.11e-112bZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Pawar V, et al.
    A novel family of plant nuclear envelope-associated proteins.
    J. Exp. Bot., 2016. 67(19): p. 5699-5710
    [PMID:27630107]
  3. Gibalová A, et al.
    Characterization of pollen-expressed bZIP protein interactions and the role of ATbZIP18 in the male gametophyte.
    Plant Reprod, 2017. 30(1): p. 1-17
    [PMID:27896439]
  4. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]
  5. Babiychuk E,Fuangthong M,Van Montagu M,Inzé D,Kushnir S
    Efficient gene tagging in Arabidopsis thaliana using a gene trap approach.
    Proc. Natl. Acad. Sci. U.S.A., 1997. 94(23): p. 12722-7
    [PMID:9356517]