PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g019534m
Common NameCISIN_1g019104mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family MYB_related
Protein Properties Length: 340aa    MW: 37315.8 Da    PI: 9.3594
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g019534mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.31.8e-1379123147
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        r +WT++E++++++a +++  + Wk+I + +g  +t  q++s+ qky
  orange1.1g019534m  79 RESWTEQEHDKFLEALQLFDRD-WKKIEAFIG-SKTVIQIRSHAQKY 123
                        789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.87E-1673129IPR009057Homeodomain-like
PROSITE profilePS5129414.98674128IPR017930Myb domain
TIGRFAMsTIGR015572.3E-1877126IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.607.7E-777129IPR009057Homeodomain-like
SMARTSM007177.9E-1178126IPR001005SANT/Myb domain
PfamPF002493.7E-1179123IPR001005SANT/Myb domain
CDDcd001672.34E-881124No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009651Biological Processresponse to salt stress
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MVSVNPNPAQ GFFFFDPMNM GHPGPNSLPP TGSYNAATTT NDSTTASAST KSTGAINTMS  60
FAEDPSKKIR KPYTITKSRE SWTEQEHDKF LEALQLFDRD WKKIEAFIGS KTVIQIRSHA  120
QKYFLKVQKN GTSEHVPPPR PKRKAAHPYP QKAPKTVHGV SQFGGQVQSS AALLEPGYIY  180
RPDSSSVLGN PVPVAALSSW SYDSVPPVNV SQVTKDDVGL PGSSNAQNFC YSSSNDSTLR  240
TWPVGETIDR GDHGKPRRVY SFLGSVFDPN STGHIQRLKQ MDPINFETVL LLMRNLAINL  300
TSPEFEDHKR LLSLYDVESE RNKFGSLHAG NSESAIPSA*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Csi.11001e-138fruit
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKU9477698e-84KU947769.1 Toxicodendron vernicifluum microsatellite c26331 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006444958.10.0protein REVEILLE 3
RefseqXP_006491181.10.0protein REVEILLE 3
SwissprotQ6R0H01e-106RVE3_ARATH; Protein REVEILLE 3
TrEMBLA0A067H2S80.0A0A067H2S8_CITSI; Uncharacterized protein
STRINGXP_006491181.10.0(Citrus sinensis)
STRINGXP_006444958.10.0(Citrus clementina)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01520.16e-92MYB_related family protein
Publications ? help Back to Top
  1. Manfield IW, et al.
    Arabidopsis Co-expression Tool (ACT): web server tools for microarray-based gene expression analysis.
    Nucleic Acids Res., 2006. 34(Web Server issue): p. W504-9
    [PMID:16845059]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Gray JA,Shalit-Kaneh A,Chu DN,Hsu PY,Harmer SL
    The REVEILLE Clock Genes Inhibit Growth of Juvenile and Adult Plants by Control of Cell Size.
    Plant Physiol., 2017. 173(4): p. 2308-2322
    [PMID:28254761]
  4. Huang KC,Lin WC,Cheng WH
    Salt hypersensitive mutant 9, a nucleolar APUM23 protein, is essential for salt sensitivity in association with the ABA signaling pathway in Arabidopsis.
    BMC Plant Biol., 2018. 18(1): p. 40
    [PMID:29490615]