PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g019375m
Common NameCISIN_1g019375mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family WRKY
Protein Properties Length: 343aa    MW: 38277.1 Da    PI: 7.1479
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g019375mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY1047.9e-33194251259
                        --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
               WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                        +Dgy+WrKYGqK vk+s++prsYYrCts++C+vkk+vers +dp+vv++tYeg+Hnh+
  orange1.1g019375m 194 EDGYRWRKYGQKAVKNSPYPRSYYRCTSQKCTVKKRVERSYQDPTVVITTYEGQHNHQ 251
                        8********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.2E-34178253IPR003657WRKY domain
SuperFamilySSF1182906.28E-29186253IPR003657WRKY domain
PROSITE profilePS5081132.397188253IPR003657WRKY domain
SMARTSM007746.7E-38193252IPR003657WRKY domain
PfamPF031061.2E-25194251IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 343 aa     Download sequence    Send to blast
MSNNEKKSSY HFYDPFDCNP HGFNRLGFNF FQDNNPSMYM NPPTPAVENL QAAAFDPTSP  60
YVSFTDCLHG NSMDYTSLSR AFDISCSSSE IITPPVDDTP KKTTAFAGDS AGATENNNNP  120
STPNSSVSSS SNEAGADEDS GNHSNKKDKQ QVKGQEDGDD DEKSKNKVNK PKKEKKQREP  180
RFAFLTKSEI DHLEDGYRWR KYGQKAVKNS PYPRSYYRCT SQKCTVKKRV ERSYQDPTVV  240
ITTYEGQHNH QCPATLRGNA AGMLSPSLLA SASMRPTFPQ EFLLSQFLPS ANNNQGVNIP  300
SSMYYQNLNI SPQQQQQQLG NQVPDYGLLQ DLVPSFINRQ QP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-281862541078Probable WRKY transcription factor 4
2lex_A2e-281862541078Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Csi.176060.0fruit
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00440DAPTransfer from AT4G18170Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006484858.10.0probable WRKY transcription factor 28
TrEMBLA0A067F4B50.0A0A067F4B5_CITSI; Uncharacterized protein
STRINGXP_006484858.10.0(Citrus sinensis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM15242693
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18170.11e-56WRKY DNA-binding protein 28